Lus10020275 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27200 52 / 1e-08 Cupredoxin superfamily protein (.1)
AT2G31050 51 / 7e-08 Cupredoxin superfamily protein (.1)
AT2G32300 50 / 2e-07 UCC1 uclacyanin 1 (.1)
AT3G60270 49 / 3e-07 Cupredoxin superfamily protein (.1)
AT5G26330 48 / 5e-07 Cupredoxin superfamily protein (.1)
AT2G02850 44 / 5e-06 ARPN plantacyanin (.1)
AT2G26720 45 / 8e-06 Cupredoxin superfamily protein (.1)
AT3G17675 42 / 4e-05 Cupredoxin superfamily protein (.1)
AT3G60280 41 / 0.0002 UCC3 uclacyanin 3 (.1)
AT4G28365 40 / 0.0004 AtENODL3 early nodulin-like protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002618 186 / 6e-61 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10002617 75 / 5e-16 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Lus10020276 72 / 1e-14 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10007026 65 / 3e-13 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10007028 65 / 4e-13 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10002616 61 / 2e-12 AT3G17675 50 / 6e-09 Cupredoxin superfamily protein (.1)
Lus10020280 59 / 7e-11 AT3G17675 79 / 2e-19 Cupredoxin superfamily protein (.1)
Lus10002608 57 / 2e-10 AT3G17675 82 / 2e-20 Cupredoxin superfamily protein (.1)
Lus10002615 56 / 6e-10 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117900 61 / 8e-12 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.013G061300 60 / 2e-11 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.013G054500 50 / 9e-08 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.002G052500 49 / 1e-07 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.013G030000 49 / 2e-07 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030450 49 / 2e-07 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.001G332200 48 / 4e-07 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.002G074000 46 / 1e-06 AT2G02850 154 / 1e-49 plantacyanin (.1)
Potri.008G151000 47 / 2e-06 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.002G161300 45 / 4e-06 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10020275 pacid=23144138 polypeptide=Lus10020275 locus=Lus10020275.g ID=Lus10020275.BGIv1.0 annot-version=v1.0
ATGGCTTCCCAATCCTTATCCAGCAAGGATTTCTTGCTTCTTACTATGGCTATGACAATTCTAGTCACTACTACTCCACCCACAGCTTTGGCTGAGACCT
TCATCGTTGGTGGTAATCAGGGATGGAGAAATGGGGTCGACTACGAGGCATGGGCTCGTGACAAGGTGTTTCGTGTCGGCGACAAACTGGTTAGTCGTGC
TATTATTGTGAATTCAGTCACTTTACTCAATGCTACATGGAATGTTCATTACACATTGGTCATTCAACTTCATAACATACTCACAATGGTCCTCATCTAT
GTACACATTAGTCACTCAACTATACATTTTCTGACAAAACGGTCACTTCTCCATCGTCTTAAACACGCAGTTTTCAAGTACCAGAAGTGCTTCCACAGCG
TGGTGAGGGTAATACTCGAGGAGCAGTTCCAGAAGTGCACCGTCCCCGCGGGAGCCAACCAGCTAACGTCCGGATCCGACATCGTTCCCCTCACGACCGA
GGGAAGGAAGTTCTTCGTGTGCGGCGTGGGAAGCAACTGCCTTGATAGCTGCCAGAAGCTTGCTATATTTGTGAGGCCACACCATGGTTAA
AA sequence
>Lus10020275 pacid=23144138 polypeptide=Lus10020275 locus=Lus10020275.g ID=Lus10020275.BGIv1.0 annot-version=v1.0
MASQSLSSKDFLLLTMAMTILVTTTPPTALAETFIVGGNQGWRNGVDYEAWARDKVFRVGDKLVSRAIIVNSVTLLNATWNVHYTLVIQLHNILTMVLIY
VHISHSTIHFLTKRSLLHRLKHAVFKYQKCFHSVVRVILEEQFQKCTVPAGANQLTSGSDIVPLTTEGRKFFVCGVGSNCLDSCQKLAIFVRPHHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27200 Cupredoxin superfamily protein... Lus10020275 0 1

Lus10020275 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.