Lus10020277 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G33340 84 / 3e-19 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
AT1G31450 81 / 2e-18 Eukaryotic aspartyl protease family protein (.1)
AT2G35615 81 / 3e-18 Eukaryotic aspartyl protease family protein (.1)
AT1G64830 80 / 4e-18 Eukaryotic aspartyl protease family protein (.1)
AT5G26330 48 / 3e-07 Cupredoxin superfamily protein (.1)
AT3G17675 45 / 2e-06 Cupredoxin superfamily protein (.1)
AT2G32300 44 / 1e-05 UCC1 uclacyanin 1 (.1)
AT3G27200 43 / 2e-05 Cupredoxin superfamily protein (.1)
AT2G03200 43 / 3e-05 Eukaryotic aspartyl protease family protein (.1)
AT2G26720 41 / 0.0001 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020278 192 / 2e-64 AT5G33340 109 / 2e-29 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10002611 173 / 1e-52 AT5G33340 392 / 9e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10002612 149 / 3e-43 AT5G33340 393 / 5e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10002613 140 / 5e-40 AT5G33340 406 / 4e-139 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10024905 122 / 1e-35 AT5G33340 191 / 2e-59 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10022917 124 / 6e-35 AT2G03200 194 / 2e-58 Eukaryotic aspartyl protease family protein (.1)
Lus10022912 125 / 1e-34 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10024903 122 / 3e-33 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10024910 119 / 4e-32 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G114400 85 / 9e-20 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Potri.003G087900 83 / 5e-19 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Potri.003G105300 65 / 1e-12 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1)
Potri.013G061300 48 / 2e-07 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.008G151000 46 / 2e-06 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.013G030450 45 / 2e-06 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 45 / 2e-06 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G054500 45 / 3e-06 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.003G117900 44 / 5e-06 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.001G209300 44 / 6e-06 AT2G02850 155 / 4e-50 plantacyanin (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10020277 pacid=23144160 polypeptide=Lus10020277 locus=Lus10020277.g ID=Lus10020277.BGIv1.0 annot-version=v1.0
ATGATCGTGCCTACCGATTTCTTCTCCGATTTTACCACTGCAGTCGAGGCACTAGTGACAGGCGGGAGCAAGACCAGCGACCCGCAAGGATTCCTCAACT
TATGCTACGTGATAGACCCGAAACTCGAGATCCCTCCAGTTGCCATGTATTTCAAAGGAGGTGGCGTGGAGTTGAATTCGATCAACCTCTTCGTTCCGAT
GAGCGAAACGGTGACATGTCTCGCTTTCTACGGTAGTGACGTGGTGAGCATTTACGGGAACTTAGCGCAGCAAGATTTTCTGTTTTCCAGTACGGATCGG
GATCACACAACGTGTTCAAGGTGGGAAAATTGGCATGCGTATATCGTCCCTTCGGATCAGAACAAGGCGCTTACATCGGGAAACGATGTCGTTACATTGA
CTAAAGGTAAACACTACTACATTTGTGGCGTCGACGGTCACTGTCTCAGTGGCCAAAAGCTCGCCGTCGACGTCAAGGGATGA
AA sequence
>Lus10020277 pacid=23144160 polypeptide=Lus10020277 locus=Lus10020277.g ID=Lus10020277.BGIv1.0 annot-version=v1.0
MIVPTDFFSDFTTAVEALVTGGSKTSDPQGFLNLCYVIDPKLEIPPVAMYFKGGGVELNSINLFVPMSETVTCLAFYGSDVVSIYGNLAQQDFLFSSTDR
DHTTCSRWENWHAYIVPSDQNKALTSGNDVVTLTKGKHYYICGVDGHCLSGQKLAVDVKG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10020277 0 1

Lus10020277 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.