Lus10020280 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17675 78 / 4e-19 Cupredoxin superfamily protein (.1)
AT2G02850 75 / 1e-17 ARPN plantacyanin (.1)
AT3G18590 68 / 2e-14 AtENODL5 early nodulin-like protein 5 (.1)
AT2G32300 69 / 3e-14 UCC1 uclacyanin 1 (.1)
AT5G26330 67 / 7e-14 Cupredoxin superfamily protein (.1)
AT5G15350 63 / 1e-12 AtENODL17 early nodulin-like protein 17 (.1)
AT3G27200 63 / 1e-12 Cupredoxin superfamily protein (.1)
AT1G45063 63 / 3e-12 copper ion binding;electron carriers (.1.2)
AT1G48940 62 / 3e-12 AtENODL6 early nodulin-like protein 6 (.1)
AT2G26720 61 / 1e-11 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002608 313 / 1e-110 AT3G17675 82 / 2e-20 Cupredoxin superfamily protein (.1)
Lus10002617 93 / 5e-23 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Lus10020276 93 / 2e-22 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10007026 89 / 2e-22 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10007027 88 / 4e-22 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10006680 87 / 1e-21 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
Lus10007025 86 / 2e-21 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10007028 84 / 2e-20 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10006682 82 / 6e-20 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G037800 100 / 3e-27 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.013G061300 97 / 7e-26 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.013G054500 96 / 2e-25 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.003G117900 91 / 2e-23 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.013G030000 87 / 4e-22 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030450 87 / 9e-22 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.002G074000 73 / 6e-17 AT2G02850 154 / 1e-49 plantacyanin (.1)
Potri.006G259000 71 / 1e-15 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 71 / 1e-15 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259101 71 / 1e-15 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10020280 pacid=23144198 polypeptide=Lus10020280 locus=Lus10020280.g ID=Lus10020280.BGIv1.0 annot-version=v1.0
ATGGCTAAACGGTTTGCGATGCTCGCCGTTTTGGCAATCGTAACGATCATGCCGGCAGCCACCGTTGTTATGGCCGCTGAATACACTGTCGGCGACACGC
AGGGGTGGAGTACTACCGTCGGAAACTACAGCCAATGGGCCGCCGGAAAAGATTTCTTCGTCGGAGATGTCCTAGTTTTCAACTACGACAAATCGAAAGA
CAGTGTGATCATAGTCAAGAGCGGTCCGGAATTCCAAAACTGTGTTCCGTTAGGATCAAACATTCTAAACAGCGGGAACGACAAGATCGTCCTCGACACC
ATTGGTAAATGGTGGTTCATCAGTGGAGTCGCTTCTCACTGTGCCGACTCCAACCAGAAGCTCGTTGTCACCGCCGAAGGTGTGCCATCGCCCGGATCAC
CCCCGGGATTGAAAACTCCTCCCGGCTCCGATCCCAATTCTGCCTACAGACTAACAAACGGCATGTCGTATTGGGTCAACGGTTTGGTTGCTGCTTCGGT
TTGCGTAGCCTTAGCCGTTAGGTTGGGTTGA
AA sequence
>Lus10020280 pacid=23144198 polypeptide=Lus10020280 locus=Lus10020280.g ID=Lus10020280.BGIv1.0 annot-version=v1.0
MAKRFAMLAVLAIVTIMPAATVVMAAEYTVGDTQGWSTTVGNYSQWAAGKDFFVGDVLVFNYDKSKDSVIIVKSGPEFQNCVPLGSNILNSGNDKIVLDT
IGKWWFISGVASHCADSNQKLVVTAEGVPSPGSPPGLKTPPGSDPNSAYRLTNGMSYWVNGLVAASVCVALAVRLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17675 Cupredoxin superfamily protein... Lus10020280 0 1

Lus10020280 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.