Lus10020944 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72230 125 / 2e-36 Cupredoxin superfamily protein (.1)
AT1G22480 110 / 2e-30 Cupredoxin superfamily protein (.1)
AT2G32300 92 / 9e-23 UCC1 uclacyanin 1 (.1)
AT5G07475 89 / 2e-22 Cupredoxin superfamily protein (.1)
AT2G44790 84 / 2e-20 UCC2 uclacyanin 2 (.1)
AT2G26720 84 / 3e-20 Cupredoxin superfamily protein (.1)
AT3G60270 84 / 4e-20 Cupredoxin superfamily protein (.1)
AT2G31050 84 / 4e-20 Cupredoxin superfamily protein (.1)
AT3G27200 82 / 7e-20 Cupredoxin superfamily protein (.1)
AT5G26330 79 / 2e-18 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008720 199 / 3e-65 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10027043 107 / 3e-29 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10025580 107 / 6e-29 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10027143 93 / 2e-23 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10012085 87 / 1e-21 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10038098 88 / 1e-20 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10002614 83 / 2e-20 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10006657 86 / 4e-20 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10041570 82 / 1e-19 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G101300 152 / 9e-47 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 152 / 4e-46 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.014G049600 96 / 8e-25 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.003G150300 94 / 3e-24 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.001G332200 91 / 6e-23 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.001G080700 90 / 1e-22 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.003G047300 90 / 2e-22 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.013G061300 85 / 5e-21 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.006G067300 86 / 2e-20 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.007G120200 85 / 5e-20 AT2G32300 118 / 3e-32 uclacyanin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10020944 pacid=23177955 polypeptide=Lus10020944 locus=Lus10020944.g ID=Lus10020944.BGIv1.0 annot-version=v1.0
ATGGCAACCTCTGTCTCATATGTTCTAGCCCTCATTCTCTGCCTAGTTACGGTGGCTCTGCCTACCACTCTGGCCACCACTTACACAGTCGGCGACACCA
GCGGCTGGGTAATTGGCTCGGACTACTCCACTTGGACCTCCGGCAAGACCTTCAAAGTTGGCGACAGCCTTGTGTTCAACTACGCGGGAGGGCACACGGT
GGACGAGGTGAGCGGGAGCGACTACAACACGTGTACGGTGGGGAAATCAATCAGCTCCGACAACAGCGGAGCCACCACCGTCGCTCTCAAGACCGCCGGC
ACCCATTACTTCATCTGCGGCGTGGCCGGCCACTGCGGCGGCGGTATGAAGCTCTCCGTAACAGTTGTGGCTGCAGGGTCCACCGCTCCCCCCACTACAT
CAACTGCTTCCCCTGCATCTCCATCGTCCGGCGGCACTTCTACCGGAACCGCTACTCCGACTACCAACCGTCCGGCGTCTAATATGCCGGATTCTTCTTC
CCTTGCCACTGTTACTCCGTCGATGGGAGCTGTTGTGGCTTCCGTTTTTGCAGCTGTTGCAGTCATGGTTTCGTCATCGTGA
AA sequence
>Lus10020944 pacid=23177955 polypeptide=Lus10020944 locus=Lus10020944.g ID=Lus10020944.BGIv1.0 annot-version=v1.0
MATSVSYVLALILCLVTVALPTTLATTYTVGDTSGWVIGSDYSTWTSGKTFKVGDSLVFNYAGGHTVDEVSGSDYNTCTVGKSISSDNSGATTVALKTAG
THYFICGVAGHCGGGMKLSVTVVAAGSTAPPTTSTASPASPSSGGTSTGTATPTTNRPASNMPDSSSLATVTPSMGAVVASVFAAVAVMVSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72230 Cupredoxin superfamily protein... Lus10020944 0 1
AT1G72230 Cupredoxin superfamily protein... Lus10008720 1.4 0.9112
AT5G40630 Ubiquitin-like superfamily pro... Lus10032107 4.5 0.9101
AT1G73140 TBL31 Plant protein of unknown funct... Lus10028141 6.0 0.8775
AT1G76750 Protein of unknown function (D... Lus10004598 7.3 0.7955
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10032894 8.1 0.9018
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10005614 9.8 0.7936
AT4G19420 Pectinacetylesterase family pr... Lus10033305 12.6 0.8647
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040697 15.1 0.8773
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10001529 17.3 0.7942
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Lus10001707 18.3 0.8774

Lus10020944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.