Lus10020984 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17800 75 / 5e-18 AtENODL22 early nodulin-like protein 22 (.1)
AT2G02850 74 / 1e-17 ARPN plantacyanin (.1)
AT5G26330 67 / 1e-14 Cupredoxin superfamily protein (.1)
AT4G12880 65 / 4e-14 AtENODL19 early nodulin-like protein 19 (.1.2)
AT2G31050 61 / 5e-12 Cupredoxin superfamily protein (.1)
AT2G32300 60 / 1e-11 UCC1 uclacyanin 1 (.1)
AT3G60270 57 / 5e-11 Cupredoxin superfamily protein (.1)
AT5G15350 57 / 5e-11 AtENODL17 early nodulin-like protein 17 (.1)
AT3G27200 56 / 2e-10 Cupredoxin superfamily protein (.1)
AT2G26720 54 / 9e-10 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041848 86 / 3e-22 AT2G02850 130 / 4e-40 plantacyanin (.1)
Lus10041849 80 / 4e-20 AT2G02850 130 / 5e-40 plantacyanin (.1)
Lus10041850 79 / 1e-19 AT2G02850 121 / 1e-36 plantacyanin (.1)
Lus10028640 78 / 2e-19 AT2G02850 151 / 3e-48 plantacyanin (.1)
Lus10028641 78 / 2e-19 AT2G02850 151 / 3e-48 plantacyanin (.1)
Lus10028395 78 / 2e-19 AT2G02850 107 / 2e-31 plantacyanin (.1)
Lus10018938 77 / 6e-19 AT2G02850 151 / 2e-48 plantacyanin (.1)
Lus10021925 72 / 2e-16 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10007026 72 / 2e-16 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G209300 93 / 3e-25 AT2G02850 155 / 4e-50 plantacyanin (.1)
Potri.002G074000 83 / 3e-21 AT2G02850 154 / 1e-49 plantacyanin (.1)
Potri.003G047300 75 / 3e-17 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.001G043600 71 / 2e-16 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.002G241500 68 / 2e-15 AT2G02850 122 / 8e-37 plantacyanin (.1)
Potri.007G104600 67 / 6e-15 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1)
Potri.008G151000 67 / 1e-14 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.006G259101 65 / 5e-14 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.010G089900 64 / 2e-13 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.017G088600 64 / 2e-13 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10020984 pacid=23148965 polypeptide=Lus10020984 locus=Lus10020984.g ID=Lus10020984.BGIv1.0 annot-version=v1.0
ATGGAGAAAGCAGCTGCAGGCCGTGGATCATCAGTTTCGGTCCTCTGCTATTTCTGCATAATTGCGATGATATTGTTCCATGGTGAGACTGCCACTGCAA
CAAAATCTTTCAAAGTTGGAGATGACGCTGGTTGGGCTATTGAGGTTGTAAATCGTTGGCCCGAGGCTAAATGCTTCAACGCCGGCGATATATTAGAATT
CACATACAACTATGAATGGCACAATGTGATCGTGGCGAACAAGACAGAGTACGAGTCATGCACTCTCCCGATCAGAGGTGGCTCAGCTTTCCAGACCGGC
GACGATTTCATTCCGTTGTACAAAGGTCACAACTACTTTTTTGATGGTGGCATTGGTCAGTGCCAACAAGGCTTTAAAATGACCATAGTCACTGGCCAGT
GTAACTAA
AA sequence
>Lus10020984 pacid=23148965 polypeptide=Lus10020984 locus=Lus10020984.g ID=Lus10020984.BGIv1.0 annot-version=v1.0
MEKAAAGRGSSVSVLCYFCIIAMILFHGETATATKSFKVGDDAGWAIEVVNRWPEAKCFNAGDILEFTYNYEWHNVIVANKTEYESCTLPIRGGSAFQTG
DDFIPLYKGHNYFFDGGIGQCQQGFKMTIVTGQCN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17800 AtENODL22 early nodulin-like protein 22 ... Lus10020984 0 1
Lus10003448 1.0 0.8928
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10034334 6.8 0.8269
AT3G16910 AAE7, ACN1 ACETATE NON-UTILIZING 1, acyl-... Lus10016861 6.9 0.8263
Lus10025316 6.9 0.8576
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 8.5 0.8576
AT5G17760 P-loop containing nucleoside t... Lus10041777 9.6 0.7458
AT5G39200 unknown protein Lus10030710 9.8 0.8576
Lus10016963 10.2 0.7761
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001042 10.2 0.8458
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10033233 11.0 0.8576

Lus10020984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.