Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38080 224 / 1e-71 ATLMCO4, IRX12, LAC4 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) AT5G03260 195 / 3e-60 LAC11 laccase 11 (.1) AT5G01190 187 / 2e-57 LAC10 laccase 10 (.1) AT2G29130 182 / 3e-55 LAC2, ATLAC2 laccase 2 (.1) AT5G58910 176 / 1e-53 LAC16 laccase 16 (.1) AT5G60020 174 / 2e-52 LAC17, ATLAC17 laccase 17 (.1) AT5G05390 157 / 6e-46 LAC12 laccase 12 (.1) AT5G07130 154 / 8e-45 LAC13 laccase 13 (.1) AT2G46570 152 / 7e-44 LAC6 laccase 6 (.1) AT1G18140 151 / 8e-44 LAC1, ATLAC1 laccase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032894 [exp] 261 / 1e-85 AT2G38080 894 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10035517 [exp] 253 / 2e-82 AT2G38080 907 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10040697 [exp] 236 / 4e-76 AT2G38080 828 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10018208 [exp] 223 / 4e-71 AT2G38080 837 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10017175 [exp] 219 / 7e-70 AT2G38080 875 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10027782 [exp] 209 / 5e-66 AT2G38080 887 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10028263 [exp] 205 / 5e-64 AT2G38080 775 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10026512 [exp] 191 / 1e-58 AT5G03260 919 / 0.0 laccase 11 (.1) Lus10019122 [exp] 191 / 1e-58 AT5G60020 938 / 0.0 laccase 17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G096900 [exp] 255 / 2e-83 AT2G38080 899 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.006G097000 [exp] 255 / 2e-83 AT2G38080 914 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.006G097100 [exp] 254 / 3e-83 AT2G38080 896 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.016G112000 [exp] 254 / 7e-83 AT2G38080 911 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.016G112100 [exp] 253 / 1e-82 AT2G38080 891 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.001G248700 [exp] 243 / 9e-79 AT2G38080 874 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.009G042500 [exp] 242 / 2e-78 AT2G38080 891 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.008G064000 [exp] 213 / 4e-67 AT2G38080 728 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.010G193100 [exp] 209 / 7e-66 AT2G38080 771 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.001G341600 [exp] 187 / 2e-57 AT5G60020 896 / 0.0 laccase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF07732 [flax] [poplar] Cu-oxidase_3 Multicopper oxidase
Representative CDS sequence Show only first row Show all	>Lus10021133 pacid=23182314 polypeptide=Lus10021133 locus=Lus10021133.g ID=Lus10021133.BGIv1.0 annot-version=v1.0 ATGGCTTATGCATCCTCCCCCTTCCTCCTCCTTCTGGTCTGCTTCCTTCCGGCTTTCGTGGACTGCTCCGTCCGTCATTATAAGTTCAATGTGGTTATGA AAAACACTACAAGGCTATGTTCGAGCAAGCCGATCGTGACAGTGAACGGCAGGTTCCCCGGGCCAACCCTCTACGCTCGGGAGGACGATACGGTGCTTGT GAAAGTCGTTAACCATGTCAAATATAATGTTTCTATTCACTGGCATGGGATTCGACAGATCAGGACCGGTTGGGCTGATGGACAAGCATTCATCACGCAA TGCCCTATCCAGCCGAGGCAGAGCTCTGTGTACAACTTCACGATCACGGGTCAGAGAGGGACGCTTCTATGGCACGCACATATTCTCTGGCTCAGGGCCA CGGTTCATGGCGATGTGATATTGTCGGTGAATGGTGGAAATCTGATACAGAAGTTGTGA
AA sequence Show only first row Show all	>Lus10021133 pacid=23182314 polypeptide=Lus10021133 locus=Lus10021133.g ID=Lus10021133.BGIv1.0 annot-version=v1.0 MAYASSPFLLLLVCFLPAFVDCSVRHYKFNVVMKNTTRLCSSKPIVTVNGRFPGPTLYAREDDTVLVKVVNHVKYNVSIHWHGIRQIRTGWADGQAFITQ CPIQPRQSSVYNFTITGQRGTLLWHAHILWLRATVHGDVILSVNGGNLIQKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10021133 [exp]	0	1
AT3G20860		ATNEK5	NIMA-related kinase 5 (.1)		Lus10031834 [exp]	3.2	0.9572
AT5G42930			alpha/beta-Hydrolases superfam...		Lus10042648 [exp]	4.5	0.9544
AT1G63440		HMA5	heavy metal atpase 5 (.1)		Lus10008309 [exp]	6.5	0.9411
AT2G03500	GARP		Homeodomain-like superfamily p...		Lus10023857 [exp]	8.9	0.9445
AT5G12950			Putative glycosyl hydrolase of...		Lus10031829 [exp]	9.2	0.9239
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Lus10014184 [exp]	10.8	0.9471
AT3G49070			Protein of unknown function (D...		Lus10039258 [exp]	11.3	0.9471
					Lus10025505 [exp]	13.2	0.9189
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10015737 [exp]	14.4	0.9409
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10013932 [exp]	14.7	0.9439

Compare expression of checked genes

Lus10021133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.