Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04370 92 / 5e-25 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT3G23230 83 / 3e-21 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G43410 82 / 6e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23220 71 / 2e-16 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT3G23240 69 / 6e-15 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT2G31230 68 / 1e-14 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT1G06160 67 / 3e-14 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1) AT4G17490 63 / 1e-12 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1) AT5G47220 62 / 2e-12 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT5G07580 62 / 2e-12 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011831 [exp] 140 / 1e-43 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10011830 [exp] 79 / 1e-19 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10021873 [exp] 74 / 2e-17 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 70 / 3e-16 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 69 / 4e-16 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10024883 [exp] 69 / 1e-15 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10042557 [exp] 67 / 9e-15 AT3G23240 155 / 7e-48 ethylene response factor 1 (.1) Lus10021193 [exp] 68 / 1e-14 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1) Lus10011829 [exp] 68 / 1e-14 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039200 [exp] 86 / 3e-22 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223100 [exp] 79 / 1e-19 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072600 [exp] 76 / 1e-18 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.008G166000 [exp] 74 / 1e-17 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 73 / 2e-17 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 73 / 3e-17 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 70 / 5e-16 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223200 [exp] 71 / 7e-16 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1) Potri.013G045200 [exp] 71 / 1e-15 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.001G079600 [exp] 70 / 2e-15 AT5G07580 145 / 1e-42 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10021196 pacid=23171360 polypeptide=Lus10021196 locus=Lus10021196.g ID=Lus10021196.BGIv1.0 annot-version=v1.0 ATGGACAATCAAGCAACAGGTGAAGAAGGCGGCGGCGGAGGAGGAGATGTAAGGTACAGAGGAGTCCGGCGCCGTCCTTGGGGAAAATTCGCGGCGGAGA TACGGGACTCGACGAGGAACGGGCAGAGGATATGGTTGGGGACATTCGACAGTGCGGAGGAAGCAGCAAGAGCATACGACCGCGCTGCGTATGCGATGAG AGGACACATTGCTGTCCTCAACTTCCCCCATGAGTACCCCATGGGGAGGGGCCCGGCTTCTGCTGCCACATCTGCAGCTGCCGGATCGTCATCCTCCAGC TCGAGACAAGTGGTGGAGTTGGAGTACTTGGACAATAGGTTGCTGGATGAGATGCTGGAGCAAGAAGAGAATCGGAGGAGGAGGCAAGGCTAA
AA sequence Show only first row Show all	>Lus10021196 pacid=23171360 polypeptide=Lus10021196 locus=Lus10021196.g ID=Lus10021196.BGIv1.0 annot-version=v1.0 MDNQATGEEGGGGGGDVRYRGVRRRPWGKFAAEIRDSTRNGQRIWLGTFDSAEEAARAYDRAAYAMRGHIAVLNFPHEYPMGRGPASAATSAAAGSSSSS SRQVVELEYLDNRLLDEMLEQEENRRRRQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10021196 [exp]	0	1
AT1G20030			Pathogenesis-related thaumatin...		Lus10004410 [exp]	1.0	0.9568
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020493 [exp]	8.9	0.9335
AT5G10530			Concanavalin A-like lectin pro...		Lus10033781 [exp]	10.7	0.9439
AT4G35030			Protein kinase superfamily pro...		Lus10017273 [exp]	16.7	0.9377
AT4G18380			F-box family protein (.1.2)		Lus10040978 [exp]	19.8	0.9241
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10010544 [exp]	23.2	0.9351
AT3G14075			Mono-/di-acylglycerol lipase, ...		Lus10008121 [exp]	28.1	0.8644
AT1G29860	WRKY	ATWRKY71, WRKY7...	WRKY DNA-binding protein 71 (....		Lus10004537 [exp]	28.3	0.9217
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Lus10040936 [exp]	28.6	0.9301
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032641 [exp]	38.7	0.9231

Compare expression of checked genes

Lus10021196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.