Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11500 152 / 4e-50 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 150 / 2e-49 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT2G03870 57 / 3e-12 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G14080 55 / 4e-11 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 50 / 4e-09 Small nuclear ribonucleoprotein family protein (.1) AT3G59810 39 / 3e-05 Small nuclear ribonucleoprotein family protein (.1) AT4G20440 39 / 8e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4) AT1G65700 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2.3) AT2G43810 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2) AT5G44500 36 / 0.0008 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017019 [exp] 158 / 2e-52 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10035639 [exp] 56 / 1e-11 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10008124 [exp] 51 / 2e-09 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013108 [exp] 41 / 2e-05 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2) Lus10023386 [exp] 39 / 9e-05 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2) Lus10038421 [exp] 39 / 0.0001 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2) Lus10042884 [exp] 38 / 0.0001 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10011877 [exp] 37 / 0.0004 AT5G48870 169 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10026860 [exp] 37 / 0.0007 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211100 [exp] 152 / 2e-50 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 150 / 3e-49 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G269500 [exp] 57 / 3e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 57 / 3e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.003G068400 [exp] 51 / 1e-09 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 50 / 2e-09 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G278000 [exp] 39 / 2e-05 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.001G440100 [exp] 39 / 9e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.011G155700 [exp] 39 / 0.0001 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.010G178700 [exp] 37 / 0.0003 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10021342 pacid=23178175 polypeptide=Lus10021342 locus=Lus10021342.g ID=Lus10021342.BGIv1.0 annot-version=v1.0 ATGAGCAGATCCGGTCAGCCTCCGGATTTGAAGAAGTACATGGATAAGAAACTTCAAATCAAGCTGAATGCGAACAGAATGGTGGTCGGAACTCTCCGTG GGTTTGACCAGTTCATGAACTTGGTTATCGACAACACTGTGGAAGTGAATGGTGAAGACAAAACTGACATAGGGATGGTGGTGATAAGAGGAAATAGCGT TGTGACTGTGGAAGCTCTGGAGCCTGTAAACAGAGGGATATAA
AA sequence Show only first row Show all	>Lus10021342 pacid=23178175 polypeptide=Lus10021342 locus=Lus10021342.g ID=Lus10021342.BGIv1.0 annot-version=v1.0 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVIDNTVEVNGEDKTDIGMVVIRGNSVVTVEALEPVNRGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11500			Small nuclear ribonucleoprotei...		Lus10021342 [exp]	0	1
AT5G09500			Ribosomal protein S19 family p...		Lus10021886 [exp]	1.0	0.9281
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	2.0	0.9263
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	4.6	0.9223
AT3G09500			Ribosomal L29 family protein ...		Lus10003306 [exp]	5.3	0.9122
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	6.3	0.9156
AT5G63010			Transducin/WD40 repeat-like su...		Lus10039042 [exp]	7.7	0.8877
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	8.7	0.9168
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10011776 [exp]	10.2	0.8899
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10023730 [exp]	10.4	0.9123
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	10.6	0.9101

Compare expression of checked genes

Lus10021342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.