Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20340 170 / 2e-55 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1) AT1G76100 160 / 2e-51 PETE1 plastocyanin 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034554 [exp] 198 / 1e-66 AT1G20340 218 / 1e-73 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1) Lus10004155 [exp] 197 / 1e-66 AT1G20340 221 / 8e-75 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1) Lus10005628 [exp] 193 / 4e-65 AT1G76100 190 / 4e-63 plastocyanin 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G246100 [exp] 178 / 1e-58 AT1G20340 192 / 3e-63 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1) Potri.002G016000 [exp] 174 / 4e-57 AT1G20340 185 / 1e-60 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF00127 [flax] [poplar] Copper-bind Copper binding proteins, plastocyanin/azurin family
Representative CDS sequence Show only first row Show all	>Lus10021839 pacid=23159309 polypeptide=Lus10021839 locus=Lus10021839.g ID=Lus10021839.BGIv1.0 annot-version=v1.0 ATGGCAATTGATGTATTGCTGGGAGGAGATGATGGGTCGTTGCCATTTGTGCCGAACAAGTTCTCCATATCAGCTGGGGAGACAATTACATTCAAGAACA ATGCTGGATTCCCTCACAACATCGTTTTCGACGAGGACGAGGTACCGAGCGGGGTGGACGTGTCAAAGATCTCGATGTCGGAGGAGGATCTGTTGAATGC ACCCGGGGAGACTTACAAAGTTGCCTTGACTGAGAAAGGAGAGTACTCTTTCTACTGCTCGCCTTACCAGGGCGCTGGCATGGTCGGCAAAGTCACTGTG CCTGTGATTTTTTTCAACGAGAGTTTCATCGTGTAA
AA sequence Show only first row Show all	>Lus10021839 pacid=23159309 polypeptide=Lus10021839 locus=Lus10021839.g ID=Lus10021839.BGIv1.0 annot-version=v1.0 MAIDVLLGGDDGSLPFVPNKFSISAGETITFKNNAGFPHNIVFDEDEVPSGVDVSKISMSEEDLLNAPGETYKVALTEKGEYSFYCSPYQGAGMVGKVTV PVIFFNESFIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20340		PETE2, DRT112	PLASTOCYANIN 2, DNA-DAMAGE-REP...		Lus10021839 [exp]	0	1
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10037013 [exp]	2.4	0.8963
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020415 [exp]	4.2	0.9013
AT3G21870		CYCP2;1	cyclin p2;1 (.1)		Lus10027148 [exp]	4.9	0.8779
AT1G21790			TRAM, LAG1 and CLN8 (TLC) lipi...		Lus10018165 [exp]	6.9	0.8664
AT4G38460		GGR	geranylgeranyl reductase (.1)		Lus10025096 [exp]	8.9	0.8882
AT1G60000			RNA-binding (RRM/RBD/RNP motif...		Lus10023723 [exp]	10.5	0.8968
AT1G31830			Amino acid permease family pro...		Lus10007593 [exp]	11.1	0.8474
AT4G14890		FdC2	ferredoxin C 2, 2Fe-2S ferredo...		Lus10010557 [exp]	12.0	0.8838
AT3G63540			Mog1/PsbP/DUF1795-like photosy...		Lus10016419 [exp]	13.9	0.8733
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020418 [exp]	17.0	0.8828

Compare expression of checked genes

Lus10021839 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.