Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23230 122 / 4e-36 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G43410 105 / 1e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G51190 102 / 2e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G17500 101 / 2e-26 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT3G23240 99 / 5e-26 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G47220 100 / 6e-26 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT2G44840 99 / 1e-25 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G61600 99 / 1e-25 AP2_ERF ERF104 ethylene response factor 104 (.1) AT5G47230 99 / 2e-25 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1) AT2G31230 96 / 2e-24 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011830 [exp] 118 / 4e-34 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 108 / 1e-30 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 106 / 6e-30 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10024883 [exp] 107 / 1e-29 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10032499 [exp] 104 / 1e-27 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1) Lus10006579 [exp] 104 / 1e-27 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10042996 [exp] 103 / 3e-27 AT5G51190 189 / 6e-60 Integrase-type DNA-binding superfamily protein (.1) Lus10013959 [exp] 99 / 7e-27 AT3G23240 124 / 2e-36 ethylene response factor 1 (.1) Lus10014655 [exp] 101 / 1e-26 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G072400 [exp] 125 / 4e-37 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 124 / 2e-36 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223100 [exp] 112 / 3e-32 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039200 [exp] 112 / 4e-32 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 108 / 2e-30 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G150800 [exp] 104 / 2e-27 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.004G051700 [exp] 101 / 2e-27 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.014G046600 [exp] 102 / 4e-27 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1) Potri.003G081200 [exp] 103 / 5e-27 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1) Potri.001G079800 [exp] 102 / 7e-27 AT5G51190 186 / 2e-58 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10021873 pacid=23158022 polypeptide=Lus10021873 locus=Lus10021873.g ID=Lus10021873.BGIv1.0 annot-version=v1.0 ATGGAAGCCAACAACAACAAATTAGCAACTTCTTCTAACAGCGTCGTCGTCGACCCAAATCATCATCAGGATCATCCGGAGCCAGGCCTAAGGTACCGCG GCGTTCGGCGGCGTCCGTGGGGCAAGTACGCGGCGGAGATACGAGATCCTGCGAAGCAAGGGGCACGCCTGTGGCTGGGGACGTTCGACACGGCGGAGGC GGCGGCTCGTGCTTACGACAAAGCTTCATTCAGCATGAGAGGACACCTCGCCATGCTCAACTTCCCTAATGAGTATTACCCCCAGCTTCATGAGGTGGGT CCCACCTATTTCCCTCGGCCTCCTCATCCATTAATGATGAGCAGCAATACTAGTAATAAAGGCGGCGGCAGTACTGGTCGGGGTGTCGTTGGGGGGAACA CGTCGGCTAGGGGTAACGGCGGCGGGGATAAGGAGAAGCAGGTGTTCGAGTTTGAGTGTTTGGACGACAGTGTGTTGGAGGAGCTTCTTGAGAATTCGTC TGAGCTAGAGAGACAACGGAGGCATCGCCGGAAGGACTAA
AA sequence Show only first row Show all	>Lus10021873 pacid=23158022 polypeptide=Lus10021873 locus=Lus10021873.g ID=Lus10021873.BGIv1.0 annot-version=v1.0 MEANNNKLATSSNSVVVDPNHHQDHPEPGLRYRGVRRRPWGKYAAEIRDPAKQGARLWLGTFDTAEAAARAYDKASFSMRGHLAMLNFPNEYYPQLHEVG PTYFPRPPHPLMMSSNTSNKGGGSTGRGVVGGNTSARGNGGGDKEKQVFEFECLDDSVLEELLENSSELERQRRHRRKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10021873 [exp]	0	1
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	4.2	0.7545
AT5G19360		CPK34	calcium-dependent protein kina...		Lus10036050 [exp]	8.5	0.6660
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10025032 [exp]	13.4	0.7249
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10017291 [exp]	13.6	0.7239
AT5G46050		ATPTR3, PTR3	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10024933 [exp]	18.2	0.7386
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	19.2	0.7035
AT5G61310			Cytochrome c oxidase subunit V...		Lus10040012 [exp]	19.9	0.6791
AT5G62440			Protein of unknown function (D...		Lus10024968 [exp]	22.4	0.7193
					Lus10041320 [exp]	26.8	0.6806
AT1G33760	AP2_ERF		Integrase-type DNA-binding sup...		Lus10003513 [exp]	27.5	0.7095

Compare expression of checked genes

Lus10021873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.