Lus10021925 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 164 / 1e-51 Cupredoxin superfamily protein (.1)
AT2G26720 119 / 8e-34 Cupredoxin superfamily protein (.1)
AT2G31050 116 / 1e-32 Cupredoxin superfamily protein (.1)
AT2G32300 96 / 2e-24 UCC1 uclacyanin 1 (.1)
AT3G17675 90 / 2e-23 Cupredoxin superfamily protein (.1)
AT3G27200 83 / 4e-20 Cupredoxin superfamily protein (.1)
AT5G07475 82 / 2e-19 Cupredoxin superfamily protein (.1)
AT4G31840 79 / 1e-18 AtENODL15 early nodulin-like protein 15 (.1)
AT2G02850 78 / 1e-18 ARPN plantacyanin (.1)
AT4G30590 79 / 2e-18 AtENODL12 early nodulin-like protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041211 269 / 7e-93 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10010533 219 / 3e-73 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10002451 187 / 2e-60 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1)
Lus10006657 101 / 1e-25 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 99 / 7e-25 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10041570 92 / 1e-23 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10041848 91 / 2e-23 AT2G02850 130 / 4e-40 plantacyanin (.1)
Lus10002615 89 / 2e-22 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
Lus10041850 88 / 2e-22 AT2G02850 121 / 1e-36 plantacyanin (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089900 187 / 1e-60 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 183 / 4e-59 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.006G259000 132 / 2e-39 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 130 / 1e-38 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259101 130 / 2e-38 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.001G268700 126 / 5e-37 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G156401 125 / 2e-36 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156100 125 / 2e-36 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.003G047300 118 / 2e-33 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G052500 116 / 4e-33 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10021925 pacid=23158005 polypeptide=Lus10021925 locus=Lus10021925.g ID=Lus10021925.BGIv1.0 annot-version=v1.0
ATGGGTATGGCTGGCAGAGCTTCTGGCTTCGCACAGCTAGTGTCAATGGCGGTGCTGCTACAGTTGGTAATCCAATCCAATGGAGCTTTGCACAAGGTCG
GAGACTCGGTGGGTTGGACTATAATCGGGAGTCCCGATTATAAACAGTGGGCGTCCACTAAGTCCTTCCAACTTGGCGACATTGTTCATTTCGAGTACAA
CGCACAGTTCCACAACGTGATGAAGGTAACCCACGCCATGTACAGAGCCTGCAACGCATCAGCTCCGTTAGAAACATACACCACCGGAAACGATTCCATC
ACCATAGCAACCCGCGGCCACCACTACTTCATCTGCGGCGTTGTCGGCCATTGCCAGTCCGGCCAGAAGGTCGACATCAACGTCCTCCGCATCGATCCTT
CTTCTTCTTCTTCTTCCTTGTCGCCATCACCGGGAGGTGCTAGAGTGGCAGTCTCACCCACACTACCTTCCGCACAATCCCCTGCTCCTTCTGCAAATTC
AGCTTCTTCCTTCATCACTCCCATGGCTCTTCTCCTCCTCGCCGCCGGCGCAATCCTCTCCCATCTCGGATTCGCTTAG
AA sequence
>Lus10021925 pacid=23158005 polypeptide=Lus10021925 locus=Lus10021925.g ID=Lus10021925.BGIv1.0 annot-version=v1.0
MGMAGRASGFAQLVSMAVLLQLVIQSNGALHKVGDSVGWTIIGSPDYKQWASTKSFQLGDIVHFEYNAQFHNVMKVTHAMYRACNASAPLETYTTGNDSI
TIATRGHHYFICGVVGHCQSGQKVDINVLRIDPSSSSSSLSPSPGGARVAVSPTLPSAQSPAPSANSASSFITPMALLLLAAGAILSHLGFA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10021925 0 1
AT2G45300 RNA 3'-terminal phosphate cycl... Lus10000788 1.4 0.9864
AT1G58070 unknown protein Lus10015482 2.8 0.9855
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Lus10012143 3.5 0.9853
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Lus10041596 4.9 0.9842
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10027782 6.3 0.9841
AT4G34050 CCoAOMT1 caffeoyl coenzyme A O-methyltr... Lus10002837 6.9 0.9826
AT1G60810 ACLA-2 ATP-citrate lyase A-2 (.1) Lus10030897 7.1 0.9689
Lus10004651 8.1 0.9766
AT1G60810 ACLA-2 ATP-citrate lyase A-2 (.1) Lus10030592 8.5 0.9729
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10035517 8.8 0.9826

Lus10021925 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.