Lus10022015 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23240 139 / 6e-41 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT1G06160 110 / 2e-29 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1)
AT2G31230 108 / 5e-29 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1)
AT5G51190 83 / 2e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G43410 79 / 1e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G04370 79 / 2e-18 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1)
AT3G23220 78 / 2e-18 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
AT5G47230 82 / 3e-18 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
AT4G17490 80 / 7e-18 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1)
AT2G44840 79 / 1e-17 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042557 261 / 4e-89 AT3G23240 155 / 7e-48 ethylene response factor 1 (.1)
Lus10014655 176 / 5e-55 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1)
Lus10006579 170 / 7e-53 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1)
Lus10011829 141 / 3e-41 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1)
Lus10021193 139 / 8e-41 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1)
Lus10033885 122 / 7e-34 AT3G23240 142 / 7e-42 ethylene response factor 1 (.1)
Lus10003562 121 / 1e-33 AT3G23240 146 / 1e-43 ethylene response factor 1 (.1)
Lus10027469 114 / 3e-31 AT3G23240 145 / 2e-43 ethylene response factor 1 (.1)
Lus10022935 109 / 2e-28 AT2G31230 145 / 4e-42 ethylene-responsive element binding factor 15 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G045200 153 / 2e-46 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1)
Potri.019G014409 138 / 1e-40 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1)
Potri.005G223200 138 / 1e-40 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1)
Potri.010G072300 136 / 8e-40 AT3G23240 201 / 2e-65 ethylene response factor 1 (.1)
Potri.002G039100 136 / 1e-39 AT3G23240 147 / 3e-44 ethylene response factor 1 (.1)
Potri.008G166200 133 / 1e-38 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1)
Potri.005G223300 126 / 9e-36 AT3G23240 163 / 5e-50 ethylene response factor 1 (.1)
Potri.002G039000 117 / 4e-32 AT3G23240 138 / 2e-40 ethylene response factor 1 (.1)
Potri.011G061700 94 / 5e-24 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1)
Potri.004G051700 90 / 4e-22 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10022015 pacid=23160269 polypeptide=Lus10022015 locus=Lus10022015.g ID=Lus10022015.BGIv1.0 annot-version=v1.0
ATGGATAATCATCATTATCAAAATGATTGTTCTAATTACCTCCCTTTCAACGAGGACGATACTGAAGAAATGCTCCTCTTTCGACTCCTCATCAACCACC
AATCCGACTCCGACTCCTCCGCCGCCGAAGAACCGTCCTCCTCCTCCTCCTCCTCTTCTGAGCATTTACAATGTTCCCCACAAGATTCGGAAGCTACGGC
GGCGTACAGGGGAGTCAGGAAGAGGCCCTGGGGCAAGTACGCGGCCGAGATAAGGGACTCCACCAGGAACGGCGTCCGCGTCTGGCTGGGGACGTTCGAC
ACCGCAGAGGCCGCCGCCTTGGCCTACGACCAGGCGGCGTTTGCGCTCCGTGGCTCGGCCGCGGTGCTAAATTTCTCGGCGGAGATAGCCAGGAGGTCTC
TCCAGGACATTGGTTATAAAGGGGGGTGTTACTCTTCGCCGGTGCTGGAGCTGAAGAAGCGGAATTCGGCCATGAGGAAGGCGGTGAGAGGGCGGAGGAG
TAAGAGGAAAGATAAGGCTGCGGCAGAGGTGGTGGAAGGGACGTCGACGGTGGTGTTTGATGATTTGGGGGCAGAGTATCTGGAGGAAATTATGGCGATT
GCCGAGAATACTAGTATGATCAGTAGTACTAGTAATGCTGACGATGATCAGCATTGGTGGTGA
AA sequence
>Lus10022015 pacid=23160269 polypeptide=Lus10022015 locus=Lus10022015.g ID=Lus10022015.BGIv1.0 annot-version=v1.0
MDNHHYQNDCSNYLPFNEDDTEEMLLFRLLINHQSDSDSSAAEEPSSSSSSSSEHLQCSPQDSEATAAYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFD
TAEAAALAYDQAAFALRGSAAVLNFSAEIARRSLQDIGYKGGCYSSPVLELKKRNSAMRKAVRGRRSKRKDKAAAEVVEGTSTVVFDDLGAEYLEEIMAI
AENTSMISSTSNADDDQHWW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Lus10022015 0 1
AT5G19890 Peroxidase superfamily protein... Lus10025535 2.0 0.9126
AT4G03510 ATRMA1, RMA1 RING membrane-anchor 1 (.1.2) Lus10011184 4.2 0.8747
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10019801 5.7 0.8753
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10031237 7.0 0.8779
AT5G36160 Tyrosine transaminase family p... Lus10033661 7.2 0.9026
AT4G27450 Aluminium induced protein with... Lus10034883 10.0 0.8831
AT2G19500 ATCKX2, CKX2 cytokinin oxidase 2 (.1) Lus10031200 14.0 0.8706
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10035289 14.3 0.8790
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10030446 17.2 0.8741
Lus10038520 24.7 0.8875

Lus10022015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.