Lus10022160 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31840 73 / 8e-17 AtENODL15 early nodulin-like protein 15 (.1)
AT5G25090 72 / 1e-16 AtENODL13 early nodulin-like protein 13 (.1)
AT2G25060 70 / 7e-16 AtENODL14 early nodulin-like protein 14 (.1)
AT3G20570 64 / 4e-13 AtENODL9 early nodulin-like protein 9 (.1)
AT4G30590 62 / 8e-13 AtENODL12 early nodulin-like protein 12 (.1)
AT2G23990 63 / 9e-13 AtENODL11 early nodulin-like protein 11 (.1.2)
AT5G57920 54 / 1e-09 AtENODL10 early nodulin-like protein 10 (.1)
AT4G32490 51 / 2e-08 AtENODL4 early nodulin-like protein 4 (.1)
AT4G28365 50 / 2e-08 AtENODL3 early nodulin-like protein 3 (.1)
AT5G14345 46 / 6e-07 AtENODL21 early nodulin-like protein 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036257 167 / 4e-54 AT2G25060 110 / 3e-31 early nodulin-like protein 14 (.1)
Lus10019955 95 / 2e-25 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1)
Lus10026880 65 / 1e-13 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10003432 65 / 1e-13 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10011158 54 / 1e-09 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10043063 54 / 2e-09 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10032111 47 / 4e-07 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10018617 45 / 3e-06 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10019405 45 / 3e-06 AT1G45063 107 / 3e-27 copper ion binding;electron carriers (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G264600 68 / 5e-15 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.006G184100 67 / 8e-15 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.018G018200 65 / 7e-14 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.011G135400 46 / 9e-07 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.006G067300 46 / 1e-06 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.017G011200 45 / 4e-06 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.011G117800 44 / 8e-06 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.001G419200 42 / 5e-05 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.001G398800 41 / 7e-05 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.003G150300 41 / 7e-05 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10022160 pacid=23156282 polypeptide=Lus10022160 locus=Lus10022160.g ID=Lus10022160.BGIv1.0 annot-version=v1.0
ATGGCACGTTTGATTTTCTTTGTATCTCTCATTTCCTTGTTGCTGGCAGCTTCTGAATCTGAAGTAAGAGAGATCATCGTCGGAGGCAAAGAGAGCAACA
CTTTTTGGAGGGTTCCTAATGGCGATCGATCCAATCTTAATTACTGGGCACAGCAAATCAGATTCTCAAAAGGAGATGTTCTCGTATTGAAAACCGTGGC
GAAAAAGGATACAGTGCTGGAAGTGAACAAGGAAGCGTACGACAGCTGCAACACGACGTCGGATTCCATAAAAAAGGTGGACGGTGACCATCTCCGGGAA
TTACCTCTGGTTCCGGCGCCGGCGCCAAGTGGATCGTACAAGGTTAGAGATTTGGGATCGGTGGCCACGGGGGCAGCGTTCGTGTCTTTGTTGCTTCTAT
GA
AA sequence
>Lus10022160 pacid=23156282 polypeptide=Lus10022160 locus=Lus10022160.g ID=Lus10022160.BGIv1.0 annot-version=v1.0
MARLIFFVSLISLLLAASESEVREIIVGGKESNTFWRVPNGDRSNLNYWAQQIRFSKGDVLVLKTVAKKDTVLEVNKEAYDSCNTTSDSIKKVDGDHLRE
LPLVPAPAPSGSYKVRDLGSVATGAAFVSLLLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25060 AtENODL14 early nodulin-like protein 14 ... Lus10022160 0 1

Lus10022160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.