Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 97 / 9e-27 ARPN plantacyanin (.1) AT2G32300 87 / 8e-22 UCC1 uclacyanin 1 (.1) AT3G27200 79 / 2e-19 Cupredoxin superfamily protein (.1) AT2G31050 79 / 3e-19 Cupredoxin superfamily protein (.1) AT5G07475 78 / 8e-19 Cupredoxin superfamily protein (.1) AT2G26720 77 / 2e-18 Cupredoxin superfamily protein (.1) AT1G17800 76 / 2e-18 AtENODL22 early nodulin-like protein 22 (.1) AT5G26330 76 / 7e-18 Cupredoxin superfamily protein (.1) AT3G60270 74 / 2e-17 Cupredoxin superfamily protein (.1) AT3G17675 71 / 7e-17 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011867 [exp] 201 / 2e-61 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1) Lus10041850 [exp] 114 / 6e-34 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10018938 [exp] 114 / 7e-34 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10041848 [exp] 114 / 1e-33 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10028640 [exp] 113 / 3e-33 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 113 / 3e-33 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10041849 [exp] 112 / 3e-33 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10028396 [exp] 94 / 9e-26 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10022350 [exp] 90 / 1e-23 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G241500 [exp] 136 / 2e-42 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.002G074000 [exp] 117 / 4e-35 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.001G209300 [exp] 108 / 9e-32 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.001G332200 [exp] 85 / 8e-22 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.008G151000 [exp] 85 / 2e-21 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 84 / 4e-21 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 84 / 9e-21 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 81 / 3e-20 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.007G104600 [exp] 80 / 3e-20 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.002G156401 [exp] 80 / 7e-20 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10022800 pacid=23160051 polypeptide=Lus10022800 locus=Lus10022800.g ID=Lus10022800.BGIv1.0 annot-version=v1.0 ATGCAGCAATCTTCACTTCTCCTCATCGTAATTCTTCTCGTTTCCCTCTCGACAAAGCTCGAAGGAATCGAGGCATCGAGTTACACGGTGGGAGGGAACT CGGGATGGAGCTACAACATCCAGAGCTGGACAGATGGGAAGAAGTTCAAACCTGGAGACACCCTCATTTTCAAGTACGATTCGTCGTTGCACGACGTGGT AGCAGTGGGGATGAGTGAGTACAAAGGATGCAGCGTTGTAGCGAATTCGAACAGCAGGAGGTACAGCAGTGGGAACGATACCGTGAAGCTGAAGAAAGGG CAGAACTACTTCATCTGTAGTATTCCGGGCCACTGCGATGCTGGCTTGAAGCTTTCCATTAGAGCTTTCTGA
AA sequence Show only first row Show all	>Lus10022800 pacid=23160051 polypeptide=Lus10022800 locus=Lus10022800.g ID=Lus10022800.BGIv1.0 annot-version=v1.0 MQQSSLLLIVILLVSLSTKLEGIEASSYTVGGNSGWSYNIQSWTDGKKFKPGDTLIFKYDSSLHDVVAVGMSEYKGCSVVANSNSRRYSSGNDTVKLKKG QNYFICSIPGHCDAGLKLSIRAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02850		ARPN	plantacyanin (.1)		Lus10022800 [exp]	0	1
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10006668 [exp]	1.7	0.9801
AT3G44710			Plant protein of unknown funct...		Lus10020562 [exp]	1.7	0.9811
AT1G70840		MLP31	MLP-like protein 31 (.1)		Lus10020497 [exp]	2.0	0.9779
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10021299 [exp]	2.4	0.9728
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039478 [exp]	2.4	0.9805
AT1G61590			Protein kinase superfamily pro...		Lus10033294 [exp]	4.5	0.9764
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10012312 [exp]	4.7	0.9636
AT5G17840			DnaJ/Hsp40 cysteine-rich domai...		Lus10013632 [exp]	4.9	0.9586
AT3G47250			Plant protein of unknown funct...		Lus10020563 [exp]	5.3	0.9715
AT3G22490			Seed maturation protein (.1)		Lus10022058 [exp]	5.7	0.9710

Compare expression of checked genes

Lus10022800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.