Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23230 84 / 8e-22 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT3G23240 77 / 2e-18 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT2G31230 76 / 1e-17 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT1G04370 72 / 2e-17 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT3G23220 72 / 2e-17 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT5G07580 75 / 3e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G43410 72 / 3e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G61590 73 / 7e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G47220 73 / 8e-17 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT2G44840 73 / 9e-17 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024883 [exp] 160 / 2e-51 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10011830 [exp] 81 / 2e-20 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10021873 [exp] 80 / 7e-20 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10011831 [exp] 77 / 3e-19 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10021196 [exp] 77 / 4e-19 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 74 / 5e-18 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10005285 [exp] 73 / 2e-17 AT3G23240 120 / 1e-34 ethylene response factor 1 (.1) Lus10025430 [exp] 73 / 3e-17 AT3G23240 132 / 6e-39 ethylene response factor 1 (.1) Lus10032499 [exp] 74 / 6e-17 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039200 [exp] 90 / 3e-24 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223100 [exp] 89 / 1e-23 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 87 / 9e-23 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072600 [exp] 80 / 4e-20 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 79 / 1e-19 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 77 / 4e-19 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G151000 [exp] 78 / 1e-18 AT5G07580 164 / 6e-50 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166000 [exp] 76 / 1e-18 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1) Potri.001G079600 [exp] 76 / 1e-17 AT5G07580 145 / 1e-42 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223200 [exp] 75 / 1e-17 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10022936 pacid=23159897 polypeptide=Lus10022936 locus=Lus10022936.g ID=Lus10022936.BGIv1.0 annot-version=v1.0 ATGGGGAGGAGGAGATCAGAGCAGCCGAGGAACGGGGAAACAGAGCAGTACGAGGAGGCCCCACCTCCTCAGTACAGAGGGATAAGGAGGCGGCCGTGGG GGAAGTTCGCCGCTGAGATAAGGGACCCCACTAGGAACGGGGCCAGGAGGTGGCTAGGCACGTTCGAGTCCGCGGAGGAGGCTGCCCGAGCTTACGACAG GGCTGCCTTCGCTTTTCGAGGCAACTTGGCTATACTCAATTTCCCCAATGAGTACCAAGCCGCCACTAACCATCACGTGCAATATTCCCAGCAGCTGCAG CTGCAGCCCCTCTTGGTGAAATGGTTGGTTGATTGGATAAAATGTTGA
AA sequence Show only first row Show all	>Lus10022936 pacid=23159897 polypeptide=Lus10022936 locus=Lus10022936.g ID=Lus10022936.BGIv1.0 annot-version=v1.0 MGRRRSEQPRNGETEQYEEAPPPQYRGIRRRPWGKFAAEIRDPTRNGARRWLGTFESAEEAARAYDRAAFAFRGNLAILNFPNEYQAATNHHVQYSQQLQ LQPLLVKWLVDWIKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10022936 [exp]	0	1
AT1G18900			Pentatricopeptide repeat (PPR)...		Lus10033110 [exp]	3.2	0.9611
AT4G08250	GRAS		GRAS family transcription fact...		Lus10008316 [exp]	4.8	0.9667
					Lus10040444 [exp]	6.0	0.9643
					Lus10003173 [exp]	12.2	0.9655
AT4G08250	GRAS		GRAS family transcription fact...		Lus10028056 [exp]	13.0	0.9654
AT1G02820			Late embryogenesis abundant 3 ...		Lus10008169 [exp]	25.1	0.9296
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10035255 [exp]	26.3	0.9386
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10021258 [exp]	29.7	0.9576
AT4G01630		ATEXP17, ATHEXP...	EXPANSIN 17, expansin A17 (.1)		Lus10009253 [exp]	31.5	0.9176
AT1G62280		SLAH1	SLAC1 homologue 1 (.1)		Lus10024306 [exp]	35.6	0.9235

Compare expression of checked genes

Lus10022936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.