Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64380 84 / 1e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G39780 60 / 1e-11 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G22190 55 / 4e-10 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G78080 54 / 2e-09 AP2_ERF CAF1, RAP2.4, WIND1 wound induced dedifferentiation 1, related to AP2 4 (.1) AT2G22200 51 / 1e-08 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G36060 43 / 1e-05 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G65130 40 / 0.0001 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003889 [exp] 97 / 2e-25 AT1G64380 197 / 4e-61 Integrase-type DNA-binding superfamily protein (.1) Lus10001898 [exp] 97 / 3e-25 AT1G64380 210 / 1e-65 Integrase-type DNA-binding superfamily protein (.1) Lus10032375 [exp] 84 / 1e-21 ND 51 / 3e-08 Lus10020913 [exp] 57 / 1e-10 AT1G78080 246 / 2e-79 wound induced dedifferentiation 1, related to AP2 4 (.1) Lus10033463 [exp] 57 / 1e-10 AT1G78080 248 / 2e-80 wound induced dedifferentiation 1, related to AP2 4 (.1) Lus10019665 [exp] 50 / 4e-08 AT4G39780 209 / 1e-67 Integrase-type DNA-binding superfamily protein (.1) Lus10022497 [exp] 49 / 8e-08 AT1G78080 248 / 2e-80 wound induced dedifferentiation 1, related to AP2 4 (.1) Lus10016801 [exp] 49 / 9e-08 AT1G78080 245 / 3e-79 wound induced dedifferentiation 1, related to AP2 4 (.1) Lus10000582 [exp] 48 / 2e-07 AT4G39780 208 / 2e-67 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G092400 [exp] 92 / 1e-23 AT1G64380 181 / 1e-54 Integrase-type DNA-binding superfamily protein (.1) Potri.003G139300 [exp] 90 / 9e-23 AT1G64380 173 / 1e-51 Integrase-type DNA-binding superfamily protein (.1) Potri.005G077300 [exp] 57 / 2e-10 AT1G78080 207 / 7e-64 wound induced dedifferentiation 1, related to AP2 4 (.1) Potri.007G090600 [exp] 55 / 6e-10 AT1G78080 205 / 4e-63 wound induced dedifferentiation 1, related to AP2 4 (.1) Potri.005G168700 [exp] 54 / 1e-09 AT1G78080 197 / 3e-60 wound induced dedifferentiation 1, related to AP2 4 (.1) Potri.002G094200 [exp] 50 / 2e-08 AT1G78080 228 / 1e-72 wound induced dedifferentiation 1, related to AP2 4 (.1) Potri.017G055400 [exp] 40 / 9e-05 AT4G13620 216 / 9e-66 Integrase-type DNA-binding superfamily protein (.1) Potri.001G315300 [exp] 39 / 0.0003 AT4G13620 194 / 3e-57 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10023102 pacid=23170363 polypeptide=Lus10023102 locus=Lus10023102.g ID=Lus10023102.BGIv1.0 annot-version=v1.0 ATGAGAGTTTGGTTAGGAACCTACGACTCGGCCGAGGCCGCCGCTTATGCTTACGACCGCGCCGCTTACAAGCTACGAGGAGAGTACGCCAGGCTCAATT TCCCCAATCTGAAGGACGACGACCCCGTGAAATTAGGGTTCGCCGATTCCGCGAAATTGAACTCCCTCAGGAGCACTGTCGATGCTAAGATTCAGTCCAT CTGTCAGAAACTGAAACGGGAGAGGGCCAAGATCGGCGCAGGCGGAGGGGACAGTGGCGGAGGAGGAAATGGATGTCGACGGCGGGTGGTCGCTGGCGAG GATGCCGTCATACGATCCGGAGTTGATATGGGAGGTTCTTGCTAA
AA sequence Show only first row Show all	>Lus10023102 pacid=23170363 polypeptide=Lus10023102 locus=Lus10023102.g ID=Lus10023102.BGIv1.0 annot-version=v1.0 MRVWLGTYDSAEAAAYAYDRAAYKLRGEYARLNFPNLKDDDPVKLGFADSAKLNSLRSTVDAKIQSICQKLKRERAKIGAGGGDSGGGGNGCRRRVVAGE DAVIRSGVDMGGSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64380	AP2_ERF		Integrase-type DNA-binding sup...		Lus10023102 [exp]	0	1
					Lus10032375 [exp]	1.4	0.9205
AT4G13150			unknown protein		Lus10025925 [exp]	2.0	0.9137
AT5G15100		ATPIN8, PIN8	PIN-FORMED 8, Auxin efflux car...		Lus10013422 [exp]	10.4	0.8239
AT3G12345			unknown protein		Lus10040344 [exp]	13.6	0.8900
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Lus10020785 [exp]	14.4	0.8562
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10002829 [exp]	14.7	0.8495
AT3G22330		ATRH53, PMH2	putative mitochondrial RNA hel...		Lus10038975 [exp]	15.3	0.8463
AT1G79480			Carbohydrate-binding X8 domain...		Lus10000278 [exp]	22.6	0.8391
AT5G48500			unknown protein		Lus10009584 [exp]	22.9	0.8284
AT3G27030			unknown protein		Lus10041551 [exp]	26.8	0.7988

Compare expression of checked genes

Lus10023102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.