Lus10023317 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18220 149 / 6e-45 Drug/metabolite transporter superfamily protein (.1)
AT4G18210 150 / 1e-44 ATPUP10 purine permease 10 (.1)
AT4G18197 131 / 1e-37 PEX17, ATPUP7, AT4G18200 PEROXIN 17, ARABIDOPSIS THALIANA PURINE PERMEASE 7, purine permease 7 (.1)
AT1G44750 129 / 3e-37 ATPUP11 purine permease 11 (.1.2.3)
AT4G18195 124 / 8e-35 ATPUP8, AT4G18200 ARABIDOPSIS THALIANA PURINE PERMEASE 8, purine permease 8 (.1)
AT4G18205 123 / 2e-34 AT4G18200 Nucleotide-sugar transporter family protein (.1)
AT5G41160 114 / 2e-31 ATPUP12 ARABIDOPSIS THALIANA PURINE PERMEASE 12, purine permease 12 (.1)
AT4G18190 107 / 2e-28 ATPUP6 purine permease 6 (.1)
AT4G08700 106 / 3e-28 ATPUP13 Drug/metabolite transporter superfamily protein (.1)
AT1G19770 92 / 8e-23 ATPUP14 purine permease 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038492 232 / 2e-76 AT4G18210 344 / 3e-116 purine permease 10 (.1)
Lus10026130 176 / 9e-55 AT4G18210 382 / 2e-131 purine permease 10 (.1)
Lus10008689 176 / 2e-54 AT4G18210 382 / 3e-131 purine permease 10 (.1)
Lus10042836 122 / 8e-37 AT4G18220 155 / 2e-47 Drug/metabolite transporter superfamily protein (.1)
Lus10040118 129 / 2e-36 AT4G18210 336 / 2e-113 purine permease 10 (.1)
Lus10030927 127 / 7e-36 AT4G18210 336 / 1e-113 purine permease 10 (.1)
Lus10028132 127 / 1e-35 AT4G18220 361 / 4e-123 Drug/metabolite transporter superfamily protein (.1)
Lus10019503 123 / 3e-34 AT1G44750 452 / 1e-159 purine permease 11 (.1.2.3)
Lus10043350 122 / 4e-34 AT1G44750 456 / 8e-161 purine permease 11 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G352100 152 / 2e-45 AT4G18210 398 / 1e-137 purine permease 10 (.1)
Potri.001G352200 142 / 1e-41 AT4G18220 315 / 1e-105 Drug/metabolite transporter superfamily protein (.1)
Potri.001G147600 141 / 3e-41 AT4G18210 315 / 7e-105 purine permease 10 (.1)
Potri.014G043900 132 / 7e-38 AT1G44750 434 / 2e-152 purine permease 11 (.1.2.3)
Potri.005G160300 83 / 1e-19 AT1G28220 413 / 8e-145 purine permease 3 (.1)
Potri.006G184900 63 / 2e-12 AT2G24220 404 / 6e-141 purine permease 5 (.1.2)
Potri.001G074100 54 / 3e-09 AT1G30840 303 / 5e-101 purine permease 4 (.1.2)
Potri.002G099600 53 / 5e-09 AT1G28220 229 / 2e-72 purine permease 3 (.1)
Potri.003G156900 53 / 1e-08 AT1G30840 323 / 4e-108 purine permease 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0184 DMT PF03151 TPT Triose-phosphate Transporter family
Representative CDS sequence
>Lus10023317 pacid=23181030 polypeptide=Lus10023317 locus=Lus10023317.g ID=Lus10023317.BGIv1.0 annot-version=v1.0
ATGGACATGAACATCTGCCTCAACTTCGCCGCCACGTCGGTCACCCTCGTGGGCCTTTTTGCGAGCGGGGAGTGGAAAAGATTGGGTGCTGAGATGACTG
ATTACAGCCTTGGAATGGCGTCGTATGTGATGACTTTGGTCGGGATCGCTGTATTCTGCCAGCTGTTTTATATCGGGGTTGTCGGGCTGATCTTTGAGGT
GTCGTCGCTGTTTTCAAATTCGATCAGTGTGGTTGGCGCTCCGATTGTCCCGATCATGGCGGTGGTGTTTTTCCATGATAAGATGAGTGGGGTTAAGGGG
GTTTCGATGGCGTTGGCAATTTGGGGGTTTGTTTCTTATATATATCCTTATTATGTTGATAATCGTGTGTCTAGGAAGGCGGCGGCTGCTGCTGCCGGCG
GTAGTAGTTCGACGTCCGGGTGA
AA sequence
>Lus10023317 pacid=23181030 polypeptide=Lus10023317 locus=Lus10023317.g ID=Lus10023317.BGIv1.0 annot-version=v1.0
MDMNICLNFAATSVTLVGLFASGEWKRLGAEMTDYSLGMASYVMTLVGIAVFCQLFYIGVVGLIFEVSSLFSNSISVVGAPIVPIMAVVFFHDKMSGVKG
VSMALAIWGFVSYIYPYYVDNRVSRKAAAAAAGGSSSTSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023317 0 1
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023318 1.0 0.9698
AT2G25770 Polyketide cyclase/dehydrase a... Lus10040227 5.0 0.8192
AT1G04220 KCS2 3-ketoacyl-CoA synthase 2 (.1) Lus10021895 5.2 0.8494
AT5G65380 MATE efflux family protein (.1... Lus10024945 8.5 0.8540
AT1G17840 AtABCG11, WBC11... DESPERADO, CUTICULAR DEFECT AN... Lus10040644 11.7 0.8241
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10027725 13.8 0.7803
AT3G24503 ALDH1A, REF1, A... REDUCED EPIDERMAL FLUORESCENCE... Lus10023626 19.3 0.8054
AT3G45740 hydrolase family protein / HAD... Lus10023480 20.4 0.7934
AT4G04750 Major facilitator superfamily ... Lus10033795 20.8 0.8033
AT1G01120 KCS1 3-ketoacyl-CoA synthase 1 (.1) Lus10010108 21.5 0.7464

Lus10023317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.