Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36450 91 / 2e-23 AP2_ERF HRD HARDY, Integrase-type DNA-binding superfamily protein (.1) AT5G25810 90 / 1e-22 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1) AT5G11590 88 / 7e-22 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1) AT1G77200 87 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G01250 86 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G16750 85 / 3e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G32800 86 / 4e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G25480 85 / 9e-21 AP2_ERF CBF3, DREB1A, ATCBF3 C-REPEAT BINDING FACTOR 3, dehydration response element B1A (.1) AT2G44940 86 / 1e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G60490 85 / 1e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014376 [exp] 125 / 2e-36 AT2G36450 167 / 2e-52 HARDY, Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 91 / 3e-23 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 88 / 4e-23 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10004738 [exp] 88 / 4e-22 AT2G35700 144 / 7e-44 ERF family protein 38 (.1) Lus10027413 [exp] 86 / 1e-21 AT1G12630 146 / 3e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10034949 [exp] 88 / 3e-21 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10038270 [exp] 86 / 5e-21 AT5G11590 168 / 4e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10031655 [exp] 84 / 9e-21 AT5G52020 143 / 7e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10043240 [exp] 84 / 2e-20 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G021000 [exp] 121 / 4e-35 AT2G36450 122 / 5e-35 HARDY, Integrase-type DNA-binding superfamily protein (.1) Potri.016G018600 [exp] 117 / 2e-33 AT2G36450 135 / 7e-40 HARDY, Integrase-type DNA-binding superfamily protein (.1) Potri.003G121200 [exp] 91 / 2e-23 AT5G52020 149 / 2e-45 Integrase-type DNA-binding superfamily protein (.1) Potri.001G187500 [exp] 92 / 3e-23 AT5G25810 157 / 9e-48 TINY, Integrase-type DNA-binding superfamily protein (.1) Potri.002G172200 [exp] 89 / 6e-23 AT1G01250 177 / 6e-57 Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 90 / 2e-22 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1) Potri.003G050700 [exp] 89 / 2e-22 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G163400 [exp] 90 / 3e-22 AT4G32800 159 / 6e-48 Integrase-type DNA-binding superfamily protein (.1) Potri.018G085700 [exp] 90 / 3e-22 AT4G32800 155 / 4e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.012G134100 [exp] 89 / 3e-22 AT5G51990 197 / 4e-63 DEHYDRATION-RESPONSIVE ELEMENT-BINDING PROTEIN 1D, C-repeat-binding factor 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10023873 pacid=23160839 polypeptide=Lus10023873 locus=Lus10023873.g ID=Lus10023873.BGIv1.0 annot-version=v1.0 ATGCAGCCAAGTCAGCAGCAGCAGCAGTACCCTTCCTACCGCGGAGTGCGCCGCCGGAGCAGCGGCAAGTGGGTGTCCGAAATCCGAGAGCCCAAGAAGC CCAACAGAATCTGGCTAGGCACATTCCCCACCCCTGAAATGGCGGCTGTCGCCTATGACGTGGCCGCGCTCGCCCTCAAAGGCCGTGATGCGGAGGTCAA CTTCCCAAACTCCTCGGCCTCGCTCCCTGTCCCTGCCTCCACTTCCCCTAGGGACATCCAGGCGGCCGCCGCCTCCTCCGCCGCCCGCCACCGCCCCCCC CGCCGGCGGCTCGGAGGCAACGATTTTGCAGAGACTCATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTATGGATGTTCCCTTGACTTATAAATAA
AA sequence Show only first row Show all	>Lus10023873 pacid=23160839 polypeptide=Lus10023873 locus=Lus10023873.g ID=Lus10023873.BGIv1.0 annot-version=v1.0 MQPSQQQQQYPSYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGRDAEVNFPNSSASLPVPASTSPRDIQAAAASSAARHRPP RRRLGGNDFAETHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMDVPLTYK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36450	AP2_ERF	HRD	HARDY, Integrase-type DNA-bind...		Lus10023873 [exp]	0	1
AT1G24620			EF hand calcium-binding protei...		Lus10028913 [exp]	1.0	0.9783
AT2G37870			Bifunctional inhibitor/lipid-t...		Lus10031925 [exp]	2.8	0.9677
AT2G36450	AP2_ERF	HRD	HARDY, Integrase-type DNA-bind...		Lus10014376 [exp]	3.9	0.9353
AT2G28790			Pathogenesis-related thaumatin...		Lus10040843 [exp]	4.0	0.9611
AT4G23610			Late embryogenesis abundant (L...		Lus10027179 [exp]	4.9	0.9636
AT4G23610			Late embryogenesis abundant (L...		Lus10039662 [exp]	5.3	0.9580
AT2G17270		PHT3;3	phosphate transporter 3;3 (.1)		Lus10035975 [exp]	7.3	0.9602
AT4G38400		ATEXPL2, ATHEXP...	EXPANSIN L2, expansin-like A2 ...		Lus10025116 [exp]	8.1	0.9367
AT4G24910			Protein of unknown function (D...		Lus10003160 [exp]	8.9	0.9609
AT5G17390			Adenine nucleotide alpha hydro...		Lus10034661 [exp]	11.4	0.9447

Compare expression of checked genes

Lus10023873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.