Plant FIBer expression Database

Lus10023889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03555 119 / 1e-32 permease, cytosine/purines, uracil, thiamine, allantoin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014397
[exp]
212 / 8e-68 AT5G03555 698 / 0.0 permease, cytosine/purines, uracil, thiamine, allantoin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G119500
[exp]
142 / 8e-41 AT5G03555 659 / 0.0 permease, cytosine/purines, uracil, thiamine, allantoin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin
Representative CDS sequence
>Lus10023889 pacid=23160820 polypeptide=Lus10023889 locus=Lus10023889.g ID=Lus10023889.BGIv1.0 annot-version=v1.0
ATGGGTCCGATCGGAGGGATTCTGTTGGCGGATTATTACCTGATTCGCCGTACTAAATTGAACGTCTCGGATCTGTACACGTTGTGCCCCACCGGGGAGT
ATTTCTACACCGGCGGGTACAATTTGGCGGCGATTGGGGCCTTGATCGTCGGGATTTTACCAGTTGTTCCTGGATTCTTGCAGAAAGTTGGAATTGTACA
GGAGACGAATGGAATTTTCGTGGGGATTTACAACAATGCTTGGTTTTTCAGCTTCTTCCTAGCTGGGTTTCTATACTGGATTGTTTCGAGTTTGGTCGGA
GACCGTAGGAGATCCGGCGATGGCAGCGATCCTCTGCTGGCTGTAGAAAATTAA
AA sequence
>Lus10023889 pacid=23160820 polypeptide=Lus10023889 locus=Lus10023889.g ID=Lus10023889.BGIv1.0 annot-version=v1.0
MGPIGGILLADYYLIRRTKLNVSDLYTLCPTGEYFYTGGYNLAAIGALIVGILPVVPGFLQKVGIVQETNGIFVGIYNNAWFFSFFLAGFLYWIVSSLVG
DRRRSGDGSDPLLAVEN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03555 permease, cytosine/purines, ur... Lus10023889
[exp]
0 1
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014690
[exp]
15.6 0.7735
AT5G43745 Protein of unknown function (D... Lus10039407
[exp]
22.4 0.7684
AT3G14470 NB-ARC domain-containing disea... Lus10022900
[exp]
26.7 0.7468
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10040148
[exp]
47.8 0.6554
AT1G13570 F-box/RNI-like superfamily pro... Lus10003016
[exp]
57.8 0.7214
AT1G67400 ELMO/CED-12 family protein (.1... Lus10037017
[exp]
59.1 0.7311
AT3G16210 F-box family protein (.1) Lus10031512
[exp]
69.1 0.6910
AT3G47570 Leucine-rich repeat protein ki... Lus10017400
[exp]
80.1 0.7382
AT3G47090 Leucine-rich repeat protein ki... Lus10034078
[exp]
91.2 0.7117
AT1G67400 ELMO/CED-12 family protein (.1... Lus10015790
[exp]
96.9 0.7231

Lus10023889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.