Lus10024194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06890 237 / 3e-78 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
AT2G30460 234 / 4e-77 Nucleotide/sugar transporter family protein (.1.2)
AT2G28315 158 / 1e-47 Nucleotide/sugar transporter family protein (.1)
AT5G42420 84 / 7e-20 Nucleotide-sugar transporter family protein (.1.2)
AT1G76670 85 / 1e-19 Nucleotide-sugar transporter family protein (.1)
AT1G21070 84 / 2e-19 Nucleotide-sugar transporter family protein (.1)
AT4G39390 81 / 4e-18 NST-K1, ATNST-KT1 A. THALIANA NUCLEOTIDE SUGAR TRANSPORTER-KT 1, nucleotide sugar transporter-KT 1 (.1.2.3)
AT4G09810 72 / 3e-15 Nucleotide-sugar transporter family protein (.1)
AT1G34020 66 / 4e-13 Nucleotide-sugar transporter family protein (.1)
AT1G77610 59 / 2e-10 EamA-like transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008596 246 / 2e-81 AT2G30460 569 / 0.0 Nucleotide/sugar transporter family protein (.1.2)
Lus10042217 239 / 1e-78 AT1G06890 201 / 1e-61 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
Lus10009918 226 / 2e-74 AT1G06890 493 / 7e-177 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
Lus10041314 146 / 2e-43 AT2G28315 420 / 1e-148 Nucleotide/sugar transporter family protein (.1)
Lus10021464 147 / 5e-43 AT2G28315 527 / 0.0 Nucleotide/sugar transporter family protein (.1)
Lus10041315 145 / 1e-42 AT2G28315 528 / 0.0 Nucleotide/sugar transporter family protein (.1)
Lus10037397 141 / 2e-40 AT2G28315 527 / 0.0 Nucleotide/sugar transporter family protein (.1)
Lus10033531 79 / 2e-17 AT4G09810 543 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10020837 78 / 6e-17 AT4G09810 527 / 0.0 Nucleotide-sugar transporter family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G154800 247 / 4e-82 AT1G06890 512 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
Potri.019G128900 237 / 3e-78 AT1G06890 550 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
Potri.009G011100 166 / 2e-50 AT2G28315 529 / 0.0 Nucleotide/sugar transporter family protein (.1)
Potri.004G211900 160 / 3e-48 AT2G28315 530 / 0.0 Nucleotide/sugar transporter family protein (.1)
Potri.005G260300 82 / 1e-18 AT1G21070 510 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.002G000500 82 / 1e-18 AT1G76670 528 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.002G064700 81 / 3e-18 AT4G09810 531 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.005G196500 81 / 4e-18 AT4G09810 543 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.005G086700 76 / 3e-16 AT4G39390 457 / 1e-162 A. THALIANA NUCLEOTIDE SUGAR TRANSPORTER-KT 1, nucleotide sugar transporter-KT 1 (.1.2.3)
Potri.007G077900 73 / 2e-15 AT4G39390 521 / 0.0 A. THALIANA NUCLEOTIDE SUGAR TRANSPORTER-KT 1, nucleotide sugar transporter-KT 1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0184 DMT PF03151 TPT Triose-phosphate Transporter family
Representative CDS sequence
>Lus10024194 pacid=23175767 polypeptide=Lus10024194 locus=Lus10024194.g ID=Lus10024194.BGIv1.0 annot-version=v1.0
ATGAGTGAGGGCCAGAAGTTCCAGTTGGGGACGGTGGGTGCTTTGAGCTTGTCGGTAGTATCGTCTGTCTCCATTGTGATATGCAATAAGGCGCTCATCA
GCACGCTTGGGTTTACTTTCGATGGACTTCTGACCAACCTAAATGTGTTTGCGTTCAAGTACACCCCTCAAGTCCTGTTCTTCATTGTCCTTTCCTGCAT
GATATCGGTATCTGTAAACTTCAGTACATTTCTGGTAATAGGAAAGACATCCCCAGTTACCTATCAGGTGCTAGGACACTTGAAAACATGCCTAGTCTTG
GCCTTTGGCTATGTTTTGCTTCGTGACCCATTTAGCTGGAGGAACATTTTAGGTATCCTTGTTGCTATAGTGGGGATGGTACTGTATTCCTACTTTTGCA
CGTTGGATACCCAGCAGAAGGCTCAAGAACTATCTACGAAACAACCCGAGGTCAATGAAAGTGAATCTGACCCTCTAATAAATGTGGAGAATGGAAGTGG
AAACTTGGCTGATAGTGCCCCTGCATGGAAGTCGAACAAGGACCTGCACGTATGA
AA sequence
>Lus10024194 pacid=23175767 polypeptide=Lus10024194 locus=Lus10024194.g ID=Lus10024194.BGIv1.0 annot-version=v1.0
MSEGQKFQLGTVGALSLSVVSSVSIVICNKALISTLGFTFDGLLTNLNVFAFKYTPQVLFFIVLSCMISVSVNFSTFLVIGKTSPVTYQVLGHLKTCLVL
AFGYVLLRDPFSWRNILGILVAIVGMVLYSYFCTLDTQQKAQELSTKQPEVNESESDPLINVENGSGNLADSAPAWKSNKDLHV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06890 nodulin MtN21 /EamA-like trans... Lus10024194 0 1
AT1G20050 HYD1 HYDRA1, C-8,7 sterol isomerase... Lus10032965 6.2 0.7638
AT3G66654 Cyclophilin-like peptidyl-prol... Lus10016265 10.2 0.7454
AT2G05840 PAA2 20S proteasome subunit PAA2 (.... Lus10027669 10.4 0.7371
AT1G18070 Translation elongation factor ... Lus10041996 11.8 0.7217
AT5G10110 unknown protein Lus10022498 12.6 0.7579
AT2G05840 PAA2 20S proteasome subunit PAA2 (.... Lus10039932 12.8 0.7090
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10002339 16.1 0.7448
AT4G00870 bHLH bHLH014 basic helix-loop-helix (bHLH) ... Lus10030212 16.6 0.6959
AT5G65980 Auxin efflux carrier family pr... Lus10001303 20.6 0.7516
AT2G19730 Ribosomal L28e protein family ... Lus10006869 25.9 0.7331

Lus10024194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.