Lus10024302 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77380 105 / 5e-28 AAP3, ATAAP3 amino acid permease 3 (.1)
AT1G44100 100 / 4e-26 AAP5 amino acid permease 5 (.1)
AT5G09220 99 / 1e-25 AAP2 amino acid permease 2 (.1)
AT5G63850 99 / 3e-25 AAP4 amino acid permease 4 (.1)
AT1G58360 77 / 2e-17 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
AT1G10010 77 / 2e-17 AAP8, ATAAP8 amino acid permease 8 (.1)
AT5G49630 74 / 1e-16 AAP6 amino acid permease 6 (.1)
AT5G23810 68 / 1e-14 AAP7 amino acid permease 7 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029703 131 / 2e-37 AT1G44100 688 / 0.0 amino acid permease 5 (.1)
Lus10042741 129 / 4e-37 AT1G77380 515 / 0.0 amino acid permease 3 (.1)
Lus10042744 97 / 5e-25 AT1G77380 667 / 0.0 amino acid permease 3 (.1)
Lus10029707 97 / 2e-24 AT1G77380 759 / 0.0 amino acid permease 3 (.1)
Lus10036777 90 / 5e-22 AT1G77380 684 / 0.0 amino acid permease 3 (.1)
Lus10028546 88 / 2e-21 AT1G77380 552 / 0.0 amino acid permease 3 (.1)
Lus10018852 88 / 2e-21 AT1G77380 702 / 0.0 amino acid permease 3 (.1)
Lus10042740 85 / 2e-20 AT1G77380 698 / 0.0 amino acid permease 3 (.1)
Lus10037150 84 / 5e-20 AT1G77380 680 / 0.0 amino acid permease 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G100100 105 / 1e-27 AT5G09220 768 / 0.0 amino acid permease 2 (.1)
Potri.005G068900 105 / 1e-27 AT5G09220 799 / 0.0 amino acid permease 2 (.1)
Potri.005G181500 100 / 1e-25 AT1G77380 728 / 0.0 amino acid permease 3 (.1)
Potri.005G181600 100 / 1e-25 AT1G77380 746 / 0.0 amino acid permease 3 (.1)
Potri.002G079500 99 / 2e-25 AT1G77380 766 / 0.0 amino acid permease 3 (.1)
Potri.002G079700 96 / 2e-24 AT1G77380 756 / 0.0 amino acid permease 3 (.1)
Potri.002G079400 96 / 3e-24 AT1G77380 765 / 0.0 amino acid permease 3 (.1)
Potri.002G080066 96 / 4e-24 AT1G77380 751 / 0.0 amino acid permease 3 (.1)
Potri.009G133600 93 / 2e-23 AT5G09220 711 / 0.0 amino acid permease 2 (.1)
Potri.001G470000 80 / 1e-18 AT5G23810 570 / 0.0 amino acid permease 7 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF01490 Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence
>Lus10024302 pacid=23174981 polypeptide=Lus10024302 locus=Lus10024302.g ID=Lus10024302.BGIv1.0 annot-version=v1.0
ATGATCGGATTTGGAATCGTACATATCTCTCTCCCAAATCCCCAAGTTCGTCGGTTATGGTTGCTCTCCATCGTGGTCGCGGTCATGTCCTTCACTTACT
CTGAGATCAAACTAGGTCTCGACATTGCCAAAGTCGCCAAAAACGGAGAAATCAAGGGAACTTCAATTGGAATCACCGTCGGAGCCGTAACTGAGATGCA
GAAACTGTGGAGGTTGTTCCAGGCACTCGCTAACATCCCATTAGCATATGCTTACTCCATCATTCTCATCGAACTCCTGGACCTGGATCCGCCGCCACTC
CTCCCGCCACTACTCATGGAAGCAACAGTACTGTTGTGA
AA sequence
>Lus10024302 pacid=23174981 polypeptide=Lus10024302 locus=Lus10024302.g ID=Lus10024302.BGIv1.0 annot-version=v1.0
MIGFGIVHISLPNPQVRRLWLLSIVVAVMSFTYSEIKLGLDIAKVAKNGEIKGTSIGITVGAVTEMQKLWRLFQALANIPLAYAYSIILIELLDLDPPPL
LPPLLMEATVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Lus10024302 0 1
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010939 2.0 0.9445
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Lus10030596 2.2 0.9507
AT5G26250 Major facilitator superfamily ... Lus10041212 3.5 0.9117
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Lus10030020 4.5 0.9288
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10010938 4.6 0.9107
AT4G30700 Pentatricopeptide repeat (PPR)... Lus10036596 6.2 0.8750
AT5G48540 receptor-like protein kinase-r... Lus10025875 6.2 0.9308
Lus10022721 6.3 0.9124
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10034505 8.5 0.9093
AT3G54490 RPB5E "RNA polymerase II fifth large... Lus10039554 11.0 0.8460

Lus10024302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.