Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23430 447 / 5e-159 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT4G11410 442 / 1e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G23420 438 / 7e-156 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT2G37540 381 / 3e-133 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G02540 367 / 2e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G50130 275 / 5e-91 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT4G24050 269 / 7e-89 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G64590 224 / 3e-71 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G27760 110 / 2e-27 FEY3, FEY FOREVER YOUNG, NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G09750 104 / 9e-26 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032282 [exp] 573 / 0 AT4G23430 459 / 8e-164 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024647 [exp] 552 / 0 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024649 [exp] 541 / 0 AT4G11410 446 / 5e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10032281 [exp] 538 / 0 AT4G11410 447 / 2e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024685 [exp] 509 / 0 AT4G23430 431 / 4e-152 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10035481 [exp] 507 / 0 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031101 [exp] 506 / 0 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10014975 [exp] 444 / 2e-157 AT4G23430 442 / 8e-157 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10038857 [exp] 439 / 2e-155 AT4G23430 436 / 2e-154 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G128700 [exp] 474 / 7e-170 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.003G128800 [exp] 446 / 5e-159 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.015G146600 [exp] 431 / 6e-153 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143600 [exp] 430 / 7e-152 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.001G103000 [exp] 418 / 5e-148 AT4G11410 446 / 4e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G143800 [exp] 414 / 3e-146 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.006G083900 [exp] 387 / 1e-135 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.T124508 [exp] 268 / 8e-89 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.015G081102 [exp] 268 / 8e-89 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.012G087800 [exp] 261 / 9e-86 AT5G50130 426 / 4e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00106 [flax] [poplar] adh_short short chain dehydrogenase
Representative CDS sequence Show only first row Show all	>Lus10024648 pacid=23161568 polypeptide=Lus10024648 locus=Lus10024648.g ID=Lus10024648.BGIv1.0 annot-version=v1.0 ATGTGGATTTGTGGATGGAAAGGAGCATCTGGGTTCTCAAGTCGCTCCACTGCCGAGCAAGTTACTAATGGAATCGACGCTTCTGCTCTCACTGCAATCG TCACAGGAGGATCGAGTGGAATCGGTAAGGAGACATCGAGGGTGCTTGCCCTGAGAGGTGTTCATGTGGTTATGGCTGTGAGAAATGTTGATGCTGGTAA GAGTGTTAAAGAAGAGATCCTTAAAGAAATCCCAAATGCTAAAGTTGACATCATGAAGCTGGATCTCAGCTCAATGGCATCAGTCAAGAAATTCGCTGCC GAATACGTCTCTTCAGGCCTTCCACTCAATCTTCTCATTAACAATGCAGGGATTATGTGTCCTTTCATGCTTTCCACAGACAACATAGAGATGCAATTTG CTACTAACCATGTTGGACATTTTCTCTTGACACATCTTTTGCTGGACACAATGAAGACGACTGCTCGTGACTGTAATGTCGAAGGAAGAATAGTTTACTT GTCATCAGAAATCCACCGTTATCCATACAAGGAAGGAGTTCGTTTCGACAAGATCAACGACAAAGCAGGGTATACCACCATGGCTTCTTATGGCCAAGCG AAGCTCGCTAACCTTCTTCATGCTAATGAGCTCGCAAGGCGCTTCAAGGAAGAAGGAGTCAATATAACTGCCAATTCACTTCACCCTGGACTCATAGCAA CAAACATTTTTCGCTACACAGGAGTTCTTAGTGCCATTATGCATACTTTTGGCAAATTGTTCATGAAAAATATTCAGCAGGGAGCAGCAACTACGTGCTA TGTGGCATTGCATCCAAAAGTGAAGGGAGTAAGTGGAAAATACTTCACTGACAGTAACGTAGGGAAAGCAAGCCCTCTGGCTATGGATGAAGAGCTGGGG AGAAAGCTGTGGGATTTCAGCTTGGACTTGATCAAACCTGTCTGCTAA
AA sequence Show only first row Show all	>Lus10024648 pacid=23161568 polypeptide=Lus10024648 locus=Lus10024648.g ID=Lus10024648.BGIv1.0 annot-version=v1.0 MWICGWKGASGFSSRSTAEQVTNGIDASALTAIVTGGSSGIGKETSRVLALRGVHVVMAVRNVDAGKSVKEEILKEIPNAKVDIMKLDLSSMASVKKFAA EYVSSGLPLNLLINNAGIMCPFMLSTDNIEMQFATNHVGHFLLTHLLLDTMKTTARDCNVEGRIVYLSSEIHRYPYKEGVRFDKINDKAGYTTMASYGQA KLANLLHANELARRFKEEGVNITANSLHPGLIATNIFRYTGVLSAIMHTFGKLFMKNIQQGAATTCYVALHPKVKGVSGKYFTDSNVGKASPLAMDEELG RKLWDFSLDLIKPVC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024648 [exp]	0	1
AT3G14590		NTMCTYPE6.2 ,NT...	Calcium-dependent lipid-bindin...		Lus10042475 [exp]	1.0	0.9294
AT4G12840			Protein of unknown function (D...		Lus10008748 [exp]	2.2	0.9040
AT5G20260			Exostosin family protein (.1)		Lus10005186 [exp]	2.4	0.9288
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	4.0	0.9092
AT5G14920			Gibberellin-regulated family p...		Lus10014519 [exp]	4.2	0.9032
AT5G14340	MYB	AtMYB40	myb domain protein 40 (.1)		Lus10032117 [exp]	6.2	0.9115
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10024770 [exp]	6.3	0.8940
AT5G46060			Protein of unknown function, D...		Lus10013944 [exp]	7.7	0.8908
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10026515 [exp]	8.9	0.9009
AT4G00460		ATROPGEF3, ROPG...	RHO guanyl-nucleotide exchange...		Lus10036353 [exp]	9.5	0.8970

Compare expression of checked genes

Lus10024648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.