Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23430 341 / 3e-118 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT4G23420 333 / 8e-115 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT4G11410 332 / 2e-114 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G02540 254 / 1e-83 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G37540 253 / 3e-83 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G24050 166 / 1e-49 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G50130 162 / 2e-48 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G64590 130 / 2e-35 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G54190 76 / 2e-15 PORA protochlorophyllide oxidoreductase A (.1.2) AT4G09750 74 / 8e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032282 [exp] 461 / 3e-165 AT4G23430 459 / 8e-164 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024647 [exp] 436 / 2e-155 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024648 [exp] 428 / 2e-152 AT4G23430 447 / 2e-159 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10032281 [exp] 414 / 1e-146 AT4G11410 447 / 2e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024649 [exp] 412 / 5e-146 AT4G11410 446 / 5e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10035481 [exp] 384 / 9e-135 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031101 [exp] 384 / 1e-134 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024685 [exp] 375 / 7e-131 AT4G23430 431 / 4e-152 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031100 [exp] 339 / 1e-117 AT4G11410 409 / 1e-144 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G128700 [exp] 353 / 6e-123 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.003G128800 [exp] 326 / 3e-112 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.001G103000 [exp] 320 / 6e-110 AT4G11410 446 / 4e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G143800 [exp] 285 / 4e-96 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.015G146600 [exp] 278 / 4e-93 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143600 [exp] 275 / 2e-91 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.006G083900 [exp] 261 / 2e-86 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G087800 [exp] 176 / 6e-53 AT5G50130 426 / 4e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.T124508 [exp] 157 / 9e-46 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.015G081102 [exp] 157 / 9e-46 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00106 [flax] [poplar] adh_short short chain dehydrogenase
Representative CDS sequence Show only first row Show all	>Lus10024650 pacid=23161625 polypeptide=Lus10024650 locus=Lus10024650.g ID=Lus10024650.BGIv1.0 annot-version=v1.0 ATGTGGATATTTGGATGGAAAGGAGCATCTGGGTTCTCGAGTTGCTCCACTGCTGAGCAAGTTACTAATGGAATCGACGCTACTGCTCTCACTGCAATTG TCACAGTTTTGGTCAACATTGAGTACTTGTGTAAATCAATCATTGAACTTTGCTTGGGGGCATCGAGTGGAATCGGTAAGGAGACATCGAGGGTGCTTGT CCTGAGAGGTGTTCATGTGGTTATGGCTGTGAGAAATGTTGATGCTGGTAAGAGTGTTAAAGAAGAGATCCTTAAAGAAATCCCAAATGCTAAAGTTGAC ATCATGAAGCTGGATCTCAGCTCAATGGCATCAGTCAAGAAATTCACCTCCGAATACGTCTCCTCAGGCCTTCCACTCAATATTTTCATTAACAATGCAG GCATCATGTGTCCTTACATGCTGGCCACAGACAACATAGAGATGCAATTTGCTACTAACCATGTTGGACATTTTCTCTTGACACATCTTCTGCTGGATAC AATGAAGACGACTGCACGTGGCAGTAATGTCGAAGGAAGAATCGTTTACTTGTCATCAGAAATCCACCGTTATCCATACAAGGAAGGAGTTCGTTTCGAC AAGATCAACGACAAAGCAAAAGCCGTTCTGAATACCTTTGGCAAATTCGTGATGAAAAATGTTCAGCAGGGAGCAGCAACTACATGCTATGTAGCATTGC ATCCACAAGTGAAGGGAGTAAGTGGAGAAGACTTCAGTGACAGTAACGTACCCAAAGCAACCGCTCTGGCTATGGAAGAAGAGCTGGGGAGAAAGCTGTG GGATTTCAGCTTGGACTTGATCAATCATTTTTGCTGA
AA sequence Show only first row Show all	>Lus10024650 pacid=23161625 polypeptide=Lus10024650 locus=Lus10024650.g ID=Lus10024650.BGIv1.0 annot-version=v1.0 MWIFGWKGASGFSSCSTAEQVTNGIDATALTAIVTVLVNIEYLCKSIIELCLGASSGIGKETSRVLVLRGVHVVMAVRNVDAGKSVKEEILKEIPNAKVD IMKLDLSSMASVKKFTSEYVSSGLPLNIFINNAGIMCPYMLATDNIEMQFATNHVGHFLLTHLLLDTMKTTARGSNVEGRIVYLSSEIHRYPYKEGVRFD KINDKAKAVLNTFGKFVMKNVQQGAATTCYVALHPQVKGVSGEDFSDSNVPKATALAMEEELGRKLWDFSLDLINHFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024650 [exp]	0	1
					Lus10040066 [exp]	12.4	0.7975
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10005809 [exp]	20.9	0.7862
AT1G12150			Plant protein of unknown funct...		Lus10039107 [exp]	23.2	0.7683
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10006232 [exp]	23.5	0.7834
AT4G38830		CRK26	cysteine-rich RLK (RECEPTOR-li...		Lus10002371 [exp]	27.8	0.7743
					Lus10039759 [exp]	29.3	0.7779
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031748 [exp]	32.0	0.7450
AT3G02645			Plant protein of unknown funct...		Lus10023185 [exp]	34.1	0.7716
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Lus10027796 [exp]	34.2	0.7459
AT4G34770			SAUR-like auxin-responsive pro...		Lus10007564 [exp]	35.7	0.7738

Compare expression of checked genes

Lus10024650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.