Lus10024883 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23230 84 / 2e-21 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT3G23240 76 / 3e-17 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT2G31230 76 / 4e-17 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1)
AT3G23220 73 / 9e-17 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
AT5G47220 74 / 1e-16 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT5G07580 74 / 2e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G06160 74 / 3e-16 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1)
AT2G44840 73 / 3e-16 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G61590 72 / 3e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G43410 71 / 3e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022936 153 / 2e-48 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1)
Lus10011830 81 / 8e-20 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1)
Lus10021873 81 / 3e-19 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1)
Lus10011831 78 / 1e-18 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10021196 77 / 1e-18 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10033884 74 / 2e-17 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1)
Lus10005285 73 / 1e-16 AT3G23240 120 / 1e-34 ethylene response factor 1 (.1)
Lus10032499 74 / 2e-16 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1)
Lus10042996 74 / 2e-16 AT5G51190 189 / 6e-60 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G039200 91 / 1e-23 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1)
Potri.005G223100 89 / 4e-23 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1)
Potri.010G072400 87 / 3e-22 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1)
Potri.010G072600 80 / 1e-19 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
Potri.008G166100 78 / 8e-19 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G151000 79 / 3e-18 AT5G07580 164 / 6e-50 Integrase-type DNA-binding superfamily protein (.1)
Potri.002G039300 77 / 3e-18 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
Potri.008G166000 76 / 4e-18 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G079600 77 / 1e-17 AT5G07580 145 / 1e-42 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G150800 76 / 6e-17 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10024883 pacid=23178927 polypeptide=Lus10024883 locus=Lus10024883.g ID=Lus10024883.BGIv1.0 annot-version=v1.0
ATGGGGAGGAGGAGATCAGAGCAGCCGAGGAACGGGGAAACAGAGCAGTACGAGGAGGCCCCACCTCCGCAGTACAGAGGGATAAGGAGGCGGCCGTGGG
GGAAGTTTGCCGCCGAGATAAGGGACCCCACCAGGAACGGTGCCAGGAGGTGGCTAGGCACGTTCGAGTCTGCCGAGGAGGCTGCCCGAGCTTACGACAG
GGCTGCCTTCGCTTTTCGAGGCAACTTGGCTATACTCAATTTCCCCAATGAGTACCAAGCGAGCAATAACCATCACGTGCAATATTCCAACCACCATCAG
CCGCAATATCAGCAGCCACAATTTCAGGAGGCTGCGGGTGGTTATTCGAGCGGTTACGAAATGGGTCAGCAGCAGGGTTCGAATTCTTCGGGGCAGGGAG
TGATTGAGTTTGAGTATTTGGATGATAACTTGTTGGATGAGCTTCTGGAATCTTATTCTGATGTTGGTTATGATGAAGGCTACTATAGGCAGCATAACTA
G
AA sequence
>Lus10024883 pacid=23178927 polypeptide=Lus10024883 locus=Lus10024883.g ID=Lus10024883.BGIv1.0 annot-version=v1.0
MGRRRSEQPRNGETEQYEEAPPPQYRGIRRRPWGKFAAEIRDPTRNGARRWLGTFESAEEAARAYDRAAFAFRGNLAILNFPNEYQASNNHHVQYSNHHQ
PQYQQPQFQEAAGGYSSGYEMGQQQGSNSSGQGVIEFEYLDDNLLDELLESYSDVGYDEGYYRQHN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23230 AP2_ERF ERF98 Integrase-type DNA-binding sup... Lus10024883 0 1
AT4G08250 GRAS GRAS family transcription fact... Lus10028056 11.8 0.9464
AT4G23690 Disease resistance-responsive ... Lus10024715 17.0 0.9431
AT2G42360 RING/U-box superfamily protein... Lus10005105 22.8 0.9413
AT1G08080 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANH... Lus10021455 26.1 0.9411
AT4G23690 Disease resistance-responsive ... Lus10024714 29.5 0.9392
AT2G38740 Haloacid dehalogenase-like hyd... Lus10030930 31.8 0.9163
Lus10024872 33.4 0.9397
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10034626 33.7 0.9405
AT3G26210 CYP71B23 "cytochrome P450, family 71, s... Lus10030708 34.6 0.9385
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10016178 37.7 0.9267

Lus10024883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.