Lus10025269 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15780 141 / 4e-42 Cupredoxin superfamily protein (.1)
AT2G15770 103 / 4e-27 Cupredoxin superfamily protein (.1)
AT4G33930 85 / 1e-19 Cupredoxin superfamily protein (.1)
AT4G34300 76 / 8e-17 Cupredoxin superfamily protein (.1)
AT3G27200 47 / 1e-06 Cupredoxin superfamily protein (.1)
AT4G32490 41 / 0.0002 AtENODL4 early nodulin-like protein 4 (.1)
AT5G53870 40 / 0.0007 AtENODL1 early nodulin-like protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009079 313 / 1e-110 AT2G15780 143 / 8e-43 Cupredoxin superfamily protein (.1)
Lus10022350 50 / 1e-07 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10002618 46 / 1e-06 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10041570 46 / 2e-06 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10020276 44 / 2e-05 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10025536 42 / 7e-05 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Lus10026064 41 / 0.0002 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10002617 41 / 0.0003 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G106000 171 / 9e-55 AT2G15780 151 / 5e-46 Cupredoxin superfamily protein (.1)
Potri.009G136200 45 / 4e-06 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Potri.017G011200 45 / 4e-06 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.001G332200 43 / 2e-05 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.013G054500 43 / 2e-05 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.019G037800 42 / 4e-05 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.001G398800 42 / 0.0001 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.011G117800 42 / 0.0001 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.003G183300 41 / 0.0001 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.013G030000 39 / 0.0004 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10025269 pacid=23157431 polypeptide=Lus10025269 locus=Lus10025269.g ID=Lus10025269.BGIv1.0 annot-version=v1.0
ATGGCACCACTTTACGCAGTACATGCAACTGCTATGATCGTGATCCTGCTGAGCTCCGCCGCTTTGGGTATCACGTCGGCCAACAAAGACTGGGGCAACG
GCAACTACGGCGGCGGTTGGGGCGGCCGCGGTGACTCGCCGAGGAACCGCCAGCCCAGCGAGCACACTCAGAGGAAGATAGTGGTGGGCGGGAAACAGAC
TTGGGAATTCGGCTTTGACTATACTAACTGGGCCATGCGCAATGGGCCTTTCTTCGTCAACGACACTTTAGTGTTTAAGTACAAGATGCCGACGGACAAC
AGTACCAGGCCACACAGCGTGTACCAGCTGCCGGATTTGAGGAGCTTCTTGAAGTGTGACGTCAGCAAGGGAAAGATGTTGGCCAACTGGACTGACGGCG
GCGGCAAAGGGTTTGAGTTCACAATGGACAAGTGGCAGCCTTACTTCTTCGCATGTGGGTCTGGCAACGGAATCCATTGCAATCTTGGCCGGATGAAGTT
CTTCGTCGTCCCCCTCCTCCCTCGCTGGTGGAACTACTGA
AA sequence
>Lus10025269 pacid=23157431 polypeptide=Lus10025269 locus=Lus10025269.g ID=Lus10025269.BGIv1.0 annot-version=v1.0
MAPLYAVHATAMIVILLSSAALGITSANKDWGNGNYGGGWGGRGDSPRNRQPSEHTQRKIVVGGKQTWEFGFDYTNWAMRNGPFFVNDTLVFKYKMPTDN
STRPHSVYQLPDLRSFLKCDVSKGKMLANWTDGGGKGFEFTMDKWQPYFFACGSGNGIHCNLGRMKFFVVPLLPRWWNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15780 Cupredoxin superfamily protein... Lus10025269 0 1
AT3G22060 Receptor-like protein kinase-r... Lus10039699 1.7 0.8753
Lus10027418 2.0 0.8258
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10005343 3.5 0.8550
AT3G22060 Receptor-like protein kinase-r... Lus10039698 3.9 0.8507
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Lus10029511 5.3 0.7547
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Lus10040475 5.7 0.8061
AT1G02360 Chitinase family protein (.1) Lus10009968 11.2 0.8183
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014689 11.5 0.8039
AT4G27290 S-locus lectin protein kinase ... Lus10014813 13.4 0.8235
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10006302 14.5 0.7510

Lus10025269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.