Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23240 94 / 2e-24 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G47220 93 / 8e-24 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT4G17500 89 / 7e-22 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT2G44840 84 / 1e-20 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G51190 83 / 5e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23220 79 / 2e-19 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT5G43410 78 / 6e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G47230 81 / 7e-19 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1) AT4G17490 81 / 8e-19 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1) AT5G61600 79 / 2e-18 AP2_ERF ERF104 ethylene response factor 104 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005285 [exp] 121 / 1e-35 AT3G23240 120 / 1e-34 ethylene response factor 1 (.1) Lus10013959 [exp] 117 / 2e-34 AT3G23240 124 / 2e-36 ethylene response factor 1 (.1) Lus10021193 [exp] 93 / 1e-23 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1) Lus10022015 [exp] 92 / 2e-23 AT3G23240 176 / 1e-55 ethylene response factor 1 (.1) Lus10011829 [exp] 91 / 1e-22 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1) Lus10006579 [exp] 90 / 2e-22 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10014655 [exp] 86 / 7e-21 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1) Lus10029334 [exp] 83 / 4e-20 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1) Lus10032499 [exp] 82 / 2e-19 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G061700 [exp] 120 / 4e-35 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1) Potri.004G051700 [exp] 116 / 2e-33 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.010G072300 [exp] 94 / 2e-24 AT3G23240 201 / 2e-65 ethylene response factor 1 (.1) Potri.013G045200 [exp] 94 / 4e-24 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.008G166200 [exp] 92 / 2e-23 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1) Potri.005G223200 [exp] 92 / 2e-23 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1) Potri.003G150800 [exp] 87 / 5e-21 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.001G079800 [exp] 86 / 1e-20 AT5G51190 186 / 2e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039100 [exp] 84 / 1e-20 AT3G23240 147 / 3e-44 ethylene response factor 1 (.1) Potri.019G014409 [exp] 84 / 2e-20 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10025430 pacid=23150778 polypeptide=Lus10025430 locus=Lus10025430.g ID=Lus10025430.BGIv1.0 annot-version=v1.0 ATGGCGTGCAGCAACGAGCTACCTTTCAACGAGAATGATTCGCAAGACATGGTGATTTACCAGATGATGAGCGAAGCTACAACGACGGCGGCATCCGCCG CCGCGAGTTTCGACCCGGTCCAGCAGGCTCCCACAACCCGGGCGGTGTCCAGGCCGCACTACCGGGGGGTACGGCGACGACCATGGGGGAAATACGCTGC GGAAATCCGGGACTCGTCGAAGCACGGGGCGAGGGTCTGGCTGGGGACTTACGAGACTGCAGAGGAAGCAGCGCTGGCGTACGATCGGGCTGCTTTCAGG ATGAGGGGGGCGAAGGCGGTGCTTAATTTTCCGCAGGAGTTGGCAACGGCGGCGGAGCCGCTGCGTAGGTTGATTGGTCATCAGGGTGGCGGGAAGAAAA AGGCGGAGGGGAGGAGTAGTGGTAGTAATTGTAGTGTTAGTAATGGCGGGAGTGATGATAGGAAGTGA
AA sequence Show only first row Show all	>Lus10025430 pacid=23150778 polypeptide=Lus10025430 locus=Lus10025430.g ID=Lus10025430.BGIv1.0 annot-version=v1.0 MACSNELPFNENDSQDMVIYQMMSEATTTAASAAASFDPVQQAPTTRAVSRPHYRGVRRRPWGKYAAEIRDSSKHGARVWLGTYETAEEAALAYDRAAFR MRGAKAVLNFPQELATAAEPLRRLIGHQGGGKKKAEGRSSGSNCSVSNGGSDDRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10025430 [exp]	0	1
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003266 [exp]	6.7	0.9491
AT2G42360			RING/U-box superfamily protein...		Lus10002194 [exp]	10.1	0.9636
AT1G01480		AT-ACC2, ACS2	1-amino-cyclopropane-1-carboxy...		Lus10032301 [exp]	11.6	0.9459
					Lus10010257 [exp]	17.0	0.9604
AT3G09520		ATEXO70H4	exocyst subunit exo70 family p...		Lus10025291 [exp]	19.4	0.9462
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041830 [exp]	20.0	0.9564
AT1G74360			Leucine-rich repeat protein ki...		Lus10003477 [exp]	22.8	0.9492
AT3G22880		ARLIM15, ATDMC1	ARABIDOPSIS THALIANA DISRUPTIO...		Lus10039383 [exp]	24.0	0.9517
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Lus10014148 [exp]	24.9	0.9556
AT2G01340		At17.1	unknown protein		Lus10016709 [exp]	25.5	0.9511

Compare expression of checked genes

Lus10025430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.