Lus10025536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27035 141 / 3e-43 AtENODL20 early nodulin-like protein 20 (.1)
AT4G12880 89 / 6e-23 AtENODL19 early nodulin-like protein 19 (.1.2)
AT5G15350 86 / 2e-21 AtENODL17 early nodulin-like protein 17 (.1)
AT3G01070 83 / 2e-20 AtENODL16 early nodulin-like protein 16 (.1)
AT2G32300 76 / 5e-17 UCC1 uclacyanin 1 (.1)
AT4G27520 69 / 5e-14 AtENODL2 early nodulin-like protein 2 (.1)
AT2G25060 66 / 8e-14 AtENODL14 early nodulin-like protein 14 (.1)
AT3G17675 64 / 1e-13 Cupredoxin superfamily protein (.1)
AT2G31050 66 / 2e-13 Cupredoxin superfamily protein (.1)
AT4G32490 61 / 9e-12 AtENODL4 early nodulin-like protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026749 114 / 2e-32 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1)
Lus10005229 108 / 4e-30 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1)
Lus10026064 79 / 1e-18 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10014356 78 / 4e-18 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1)
Lus10041570 72 / 6e-16 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10027143 73 / 8e-16 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10025535 71 / 2e-14 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10002614 66 / 7e-14 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10022350 66 / 1e-13 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G219800 150 / 2e-46 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.001G219900 114 / 2e-32 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1)
Potri.017G088500 105 / 9e-29 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.003G183300 84 / 3e-20 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.001G043600 79 / 1e-18 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.017G088600 78 / 3e-18 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.001G332200 72 / 2e-16 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.004G121100 72 / 4e-16 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.013G030000 71 / 8e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030450 71 / 9e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10025536 pacid=23145033 polypeptide=Lus10025536 locus=Lus10025536.g ID=Lus10025536.BGIv1.0 annot-version=v1.0
ATGACGATTCGGCCAACAGCGAGAGTAGCCATGTTCCTGCTGGCCATTACAGCTTTGACTGGTACACCTGAAGGCAGAGATCCAGTTCTCTACAGGGTTG
GCGGTGGAAGGTACAGTTGGGTTCCAGGGACCAACTTCACTACCTGGGCGTCTCAACAGCAGTTCTACGTTGGTGACTGGCTCTACTTTGGGTTCAACAA
GACGATGTACAATGTGCTGGAGGTGAACAAGAGGAGCTACGACCAATGCAGAGGAGACAACTTCATCGCCAACATCACTAGAGGAGGCCGCGACGTGTTC
AATCTCACCGAGCCAATGCCCTACTACTTCATATGCAGCCGCTCTACACACTGCTCCCTCCAGGGTATGAAGGTTGAAGTTCTAGTCACTGATCCGACAG
TGCCTCTCCAGGCTATGACCAGCAGCAGCTCTTCTCCTCCATGTCCAACCACCACAACTATTTCAGCAGCAGTCATCTTATTCCTGTGTTCGTTCCAAGT
GTTGCATTTACTAAGCTACAGGTTTTGA
AA sequence
>Lus10025536 pacid=23145033 polypeptide=Lus10025536 locus=Lus10025536.g ID=Lus10025536.BGIv1.0 annot-version=v1.0
MTIRPTARVAMFLLAITALTGTPEGRDPVLYRVGGGRYSWVPGTNFTTWASQQQFYVGDWLYFGFNKTMYNVLEVNKRSYDQCRGDNFIANITRGGRDVF
NLTEPMPYYFICSRSTHCSLQGMKVEVLVTDPTVPLQAMTSSSSSPPCPTTTTISAAVILFLCSFQVLHLLSYRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10025536 0 1
AT3G54200 Late embryogenesis abundant (L... Lus10039665 4.8 0.8052
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10005360 4.9 0.6928
AT1G17930 Aminotransferase-like, plant m... Lus10004830 7.5 0.7032
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10035001 8.4 0.6629
Lus10005203 9.8 0.6185
AT5G15110 Pectate lyase family protein (... Lus10033018 11.5 0.6883
AT3G18180 Glycosyltransferase family 61 ... Lus10032457 11.8 0.6871
AT5G53820 Late embryogenesis abundant pr... Lus10003056 23.7 0.6231
AT3G45290 ATMLO3, MLO3 MILDEW RESISTANCE LOCUS O 3, S... Lus10012241 29.0 0.6354
AT1G17930 Aminotransferase-like, plant m... Lus10005495 29.4 0.6164

Lus10025536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.