Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77470 568 / 0 EMB2810, RFC5, RFC3 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) AT1G63160 225 / 4e-71 EMB2811, RFC2 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) AT1G21690 213 / 3e-66 RFC4, EMB1968 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) AT5G27740 133 / 1e-35 RFC3, EMB251, EMB161, EMB2775 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) AT5G45720 70 / 1e-12 AAA-type ATPase family protein (.1.2) AT1G14460 68 / 5e-12 AAA-type ATPase family protein (.1) AT1G24290 67 / 7e-12 AAA-type ATPase family protein (.1) AT2G02480 64 / 6e-11 STI STICHEL, AAA-type ATPase family protein (.1) AT4G18820 58 / 6e-09 AAA-type ATPase family protein (.1) AT5G22010 58 / 8e-09 ATRFC1 replication factor C 1, replication factor C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018144 [exp] 734 / 0 AT1G77470 564 / 0.0 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) Lus10008003 [exp] 221 / 2e-69 AT1G63160 605 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Lus10024504 [exp] 221 / 2e-69 AT1G63160 615 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Lus10028543 [exp] 195 / 3e-59 AT1G21690 563 / 0.0 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) Lus10019391 [exp] 123 / 7e-32 AT5G27740 643 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10043248 [exp] 90 / 1e-19 AT5G27740 561 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10041764 [exp] 83 / 6e-17 AT5G27740 269 / 3e-84 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10028316 [exp] 76 / 1e-14 AT5G27740 271 / 6e-86 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10013372 [exp] 70 / 8e-13 AT5G22010 1128 / 0.0 replication factor C 1, replication factor C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G081200 [exp] 588 / 0 AT1G77470 577 / 0.0 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) Potri.003G123200 [exp] 224 / 9e-71 AT1G63160 587 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Potri.005G181300 [exp] 206 / 1e-63 AT1G21690 551 / 0.0 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) Potri.002G080100 [exp] 170 / 4e-49 AT1G21690 505 / 1e-180 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) Potri.005G180001 [exp] 120 / 7e-33 AT1G77470 0 / 1 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) Potri.019G040000 [exp] 121 / 2e-31 AT5G27740 621 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.011G023800 [exp] 75 / 2e-14 AT1G24290 689 / 0.0 AAA-type ATPase family protein (.1) Potri.005G120901 [exp] 68 / 4e-12 AT5G27740 240 / 8e-72 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.007G022900 [exp] 67 / 7e-12 AT5G27740 261 / 2e-82 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.004G061700 [exp] 65 / 3e-11 AT4G18820 1031 / 0.0 AAA-type ATPase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0604 [flax] [poplar] post-AAA PF08542 [flax] [poplar] Rep_fac_C Replication factor C C-terminal domain CL0023 [flax] [poplar] P-loop_NTPase PF00004 [flax] [poplar] AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence Show only first row Show all	>Lus10025689 pacid=23145055 polypeptide=Lus10025689 locus=Lus10025689.g ID=Lus10025689.BGIv1.0 annot-version=v1.0 ATGGCCCAATCTATCTCGCCGATGGAAATAGACAGCACCGGTGAGAAGCAGAACAGAAACGCCTCTTCCAAAGGCAAATCTATTGCCGTCGGCAGCGACG GCACTCATTCCAACTCCAAGGCAACACCATGGGTCGAGAAGTACCGACCTCAATCACTGGACGACGTCACCGCTCACCGTGACATCATTGATACCATTGA AAGGTTGACTAACGAGAAGAAACTACCGCATCTATTGCTGTATGGACCTCCCGGCACTGGGAAAACGTCGACTATACTCGCTGTGGCGAGGAAGCTCTAC GGTTCTGATTACCGTAAGATGATTCTCGAGCTGAATGCTTCGGATGATAGAGGAATTGATGTTGTCAGGCAGCAGATACAGGACTTTGCTAGCAGCCAGA GCTTCTCATTCGGTGGACCAAGGTCGGGTGTGAAGTTGGTCTTACTTGATGAAGCTGATGCCATGACCAAAGATGCACAATTTGCCTTGCGTAGAGTGAT TGAGAAGTATACAAAGAGTACTCGGTTTGCACTTATCTGTAACCACGTGAACAAGATCATTCCAGCTCTACAGTCCCGTTGTACACGTTTCCGGTTTGCT CCACTTGATCCTGTCCATGTCAGTGGACGTTTAAGGCATGTCATAGAGGCTGAACGGCTCGACGTAACTGAAACTGGCTTGGCAGCACTTGTGCGGCTTA GCAACGGTGACATGAGAAAGGCTTTGAACATTCTACAGGCAACACAAATGGCGTCACAGCATATCACAGAAGAAGCTGTCTACCTCTGCACTGGAAATCC GTTGCCTAAAGACATAGAGCAAATATGCTTCTGGCTCTTGAACGAGTCATTTGTTGATAGTTTCAAACGTATTGCTGAAATGAAGAACCGTAAAGGATTG GCTATAGTGGATATAGTAAGAGAAGTAACAATGTTTATTTTCCGGATCAAGATGCCATCAGATGTACGAGTCAAGTTAATCAACGATATGGCTGACATAG AGTACCGGTTGAGTTTTGGATGCAGCGACAAGTTGCAGCTTGGCTCACTAATTGCTTCGTTCACCGGCGCTCGATCTGCTCTCGTTGCTGCTGCGAAATA G
AA sequence Show only first row Show all	>Lus10025689 pacid=23145055 polypeptide=Lus10025689 locus=Lus10025689.g ID=Lus10025689.BGIv1.0 annot-version=v1.0 MAQSISPMEIDSTGEKQNRNASSKGKSIAVGSDGTHSNSKATPWVEKYRPQSLDDVTAHRDIIDTIERLTNEKKLPHLLLYGPPGTGKTSTILAVARKLY GSDYRKMILELNASDDRGIDVVRQQIQDFASSQSFSFGGPRSGVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALICNHVNKIIPALQSRCTRFRFA PLDPVHVSGRLRHVIEAERLDVTETGLAALVRLSNGDMRKALNILQATQMASQHITEEAVYLCTGNPLPKDIEQICFWLLNESFVDSFKRIAEMKNRKGL AIVDIVREVTMFIFRIKMPSDVRVKLINDMADIEYRLSFGCSDKLQLGSLIASFTGARSALVAAAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77470		EMB2810, RFC5, ...	replication factor C 5, EMBRYO...		Lus10025689 [exp]	0	1
AT3G13940			DNA binding;DNA-directed RNA p...		Lus10029818 [exp]	3.9	0.8460
AT3G08880			unknown protein		Lus10022668 [exp]	4.6	0.7984
AT4G32910			unknown protein		Lus10011625 [exp]	9.6	0.8134
AT1G69630			F-box/RNI-like superfamily pro...		Lus10024695 [exp]	10.4	0.7793
AT1G60640			unknown protein		Lus10017621 [exp]	11.7	0.7307
AT3G02860	C2H2ZnF		zinc ion binding (.1.2)		Lus10037693 [exp]	16.2	0.7946
AT2G18410			unknown protein		Lus10009164 [exp]	18.2	0.7932
AT3G52660			RNA-binding (RRM/RBD/RNP motif...		Lus10034195 [exp]	19.4	0.8130
AT2G42260		PYM, UVI4	POLYCHOME, uv-b-insensitive 4 ...		Lus10008728 [exp]	20.4	0.8236
AT3G51290			Protein of unknown function (D...		Lus10013564 [exp]	21.8	0.7283

Compare expression of checked genes

Lus10025689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.