Lus10026064 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15350 97 / 8e-26 AtENODL17 early nodulin-like protein 17 (.1)
AT4G12880 92 / 6e-24 AtENODL19 early nodulin-like protein 19 (.1.2)
AT3G01070 89 / 1e-22 AtENODL16 early nodulin-like protein 16 (.1)
AT2G27035 89 / 1e-22 AtENODL20 early nodulin-like protein 20 (.1)
AT3G17675 78 / 4e-19 Cupredoxin superfamily protein (.1)
AT2G32300 75 / 2e-16 UCC1 uclacyanin 1 (.1)
AT2G25060 74 / 2e-16 AtENODL14 early nodulin-like protein 14 (.1)
AT2G31050 74 / 2e-16 Cupredoxin superfamily protein (.1)
AT3G27200 72 / 3e-16 Cupredoxin superfamily protein (.1)
AT1G17800 71 / 5e-16 AtENODL22 early nodulin-like protein 22 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014356 309 / 2e-109 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1)
Lus10005229 86 / 2e-21 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1)
Lus10005231 86 / 3e-21 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1)
Lus10030690 86 / 3e-21 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1)
Lus10012165 80 / 5e-19 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10026749 77 / 9e-18 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1)
Lus10002618 74 / 3e-17 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10007026 74 / 8e-17 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10025536 74 / 1e-16 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G043600 209 / 7e-70 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.003G183300 205 / 9e-68 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.017G088600 97 / 8e-26 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.017G088500 86 / 2e-21 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.001G219800 85 / 1e-20 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.003G117900 83 / 3e-20 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.003G047300 82 / 1e-19 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.004G121100 81 / 2e-19 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.013G030000 78 / 2e-18 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.001G219900 77 / 3e-18 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10026064 pacid=23173266 polypeptide=Lus10026064 locus=Lus10026064.g ID=Lus10026064.BGIv1.0 annot-version=v1.0
ATGTCCACCAGCTCAACTAATTCAGCAGCTTATCCAATCTCGTTGGTGCTTTTTTGCATCCTCATCTCCTCAATCGCCGTCAACGGCACCGACCACATCG
TCGGAGCCAACAAGGGTTGGAATCCAGGCATCAACTACACTCTCTGGGCCAACAACCAAACCTTCTATGTCGGCGATTTCATCTCATTTAGGTACCAGAA
GACACAGTACAACGTTTTCAGAGTGAACGAGACTGGGTACGACAACTGTACGACGGAAGGAGCGATGGGGAACTGGAGCAGTGGGAAAGATTTCATTCTT
CTTGATATGGCTAAAAGATACTACTTTATTTGTGGGAATGGCCAGTGCTTTAACGGGATGAAGGTTTCTGTTGTTGTACACCCTCTGTCGCCGCCGCCGG
GGGCTCCCGGCATGAATAGTACACATTCTGCTGCTCCTCCTCCGATGGCTGTGGGGTTGGTTGGCTTCGGTTTGAGACAGGCCTTGGTTTTGGGGTTGGG
TTGTATCTGGTTTGGATTTAGCTGGTTGTGA
AA sequence
>Lus10026064 pacid=23173266 polypeptide=Lus10026064 locus=Lus10026064.g ID=Lus10026064.BGIv1.0 annot-version=v1.0
MSTSSTNSAAYPISLVLFCILISSIAVNGTDHIVGANKGWNPGINYTLWANNQTFYVGDFISFRYQKTQYNVFRVNETGYDNCTTEGAMGNWSSGKDFIL
LDMAKRYYFICGNGQCFNGMKVSVVVHPLSPPPGAPGMNSTHSAAPPPMAVGLVGFGLRQALVLGLGCIWFGFSWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10026064 0 1
AT2G20760 Clathrin light chain protein (... Lus10018582 4.2 0.9738
AT4G16515 RGF6 root meristem growth factor 6,... Lus10008506 11.3 0.9781
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10014356 12.7 0.9515
AT4G34770 SAUR-like auxin-responsive pro... Lus10012185 17.6 0.9760
Lus10031379 22.4 0.9492
Lus10019223 24.1 0.9736
AT1G26945 bHLH KDR, PRE6 KIDARI, basic helix-loop-helix... Lus10036732 26.5 0.9726
AT2G37640 ATHEXPALPHA1.9,... ARABIDOPSIS THALIANA EXPANSIN ... Lus10010841 26.6 0.9581
AT3G61640 AGP20, ATAGP20 arabinogalactan protein 20 (.1... Lus10032355 28.2 0.9731
AT4G38840 SAUR-like auxin-responsive pro... Lus10008991 29.7 0.9611

Lus10026064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.