Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76860 133 / 3e-42 Small nuclear ribonucleoprotein family protein (.1) AT1G21190 132 / 9e-42 Small nuclear ribonucleoprotein family protein (.1) AT3G62840 41 / 1e-05 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 41 / 1e-05 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040487 [exp] 150 / 1e-48 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10011293 [exp] 150 / 1e-48 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10042341 [exp] 101 / 3e-29 AT1G76860 132 / 2e-41 Small nuclear ribonucleoprotein family protein (.1) Lus10030367 [exp] 38 / 0.0002 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10007876 [exp] 38 / 0.0002 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10026556 [exp] 37 / 0.0003 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10013840 [exp] 37 / 0.0003 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G068800 [exp] 141 / 2e-45 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.005G191600 [exp] 141 / 2e-45 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.002G204300 [exp] 40 / 3e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.014G129100 [exp] 40 / 3e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10026326 pacid=23156463 polypeptide=Lus10026326 locus=Lus10026326.g ID=Lus10026326.BGIv1.0 annot-version=v1.0 ATGTCGACCGAAGAGGAGAGCGCAGTGAAGGAGCCTTTGGATCTCATCAGACTTAGTCTCGACGAGCGCATCTACGTCAAGCTCCGTTCCGACCGAGAAC TCCGCGGCAAGCTTCATGCTTATGATCAGCATTTAAACATGATTCTTGGGGATGTTGAAGAAACTGTGACTACAGTGGAAATTGATGATGAAACTTATGA AGAGATTGTCAGGCATACGAAGCGCAATGTACCTTTTCTATTCGTCAGAGGAGATGGAGTCATATTGGTTTCTCCGCCATTGAGGACTGCTTGA
AA sequence Show only first row Show all	>Lus10026326 pacid=23156463 polypeptide=Lus10026326 locus=Lus10026326.g ID=Lus10026326.BGIv1.0 annot-version=v1.0 MSTEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEETVTTVEIDDETYEEIVRHTKRNVPFLFVRGDGVILVSPPLRTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76860			Small nuclear ribonucleoprotei...		Lus10026326 [exp]	0	1
AT2G31140			Peptidase S24/S26A/S26B/S26C f...		Lus10022921 [exp]	1.0	0.9095
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10017135 [exp]	2.4	0.9047
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10014951 [exp]	3.0	0.8516
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10010928 [exp]	3.0	0.8999
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	3.5	0.8720
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Lus10030297 [exp]	4.6	0.8626
AT3G52270			Transcription initiation facto...		Lus10030963 [exp]	5.1	0.8427
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Lus10039887 [exp]	5.5	0.8680
AT3G02220			unknown protein		Lus10043249 [exp]	8.0	0.8561
AT1G66930			Protein kinase superfamily pro...		Lus10022367 [exp]	9.9	0.8478

Compare expression of checked genes

Lus10026326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.