Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62840 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) AT1G21190 54 / 6e-11 Small nuclear ribonucleoprotein family protein (.1) AT1G76860 53 / 2e-10 Small nuclear ribonucleoprotein family protein (.1) AT4G20440 41 / 4e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4) AT5G44500 40 / 5e-05 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013840 [exp] 208 / 1e-71 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10030367 [exp] 207 / 3e-71 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10007876 [exp] 207 / 3e-71 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10011293 [exp] 49 / 1e-08 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 49 / 1e-08 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10026326 [exp] 49 / 2e-08 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10023386 [exp] 41 / 5e-05 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2) Lus10038421 [exp] 40 / 6e-05 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013108 [exp] 40 / 0.0001 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G204300 [exp] 196 / 5e-67 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.014G129100 [exp] 196 / 5e-67 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G068800 [exp] 52 / 7e-10 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.005G191600 [exp] 52 / 8e-10 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.014G045700 [exp] 49 / 8e-09 AT3G62840 54 / 5e-11 Small nuclear ribonucleoprotein family protein (.1.2) Potri.011G155700 [exp] 41 / 3e-05 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G440100 [exp] 41 / 3e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10026556 pacid=23164200 polypeptide=Lus10026556 locus=Lus10026556.g ID=Lus10026556.BGIv1.0 annot-version=v1.0 ATGGAAGAGGATGTTCCTAACAAGGAGGACGAATTCAGCACAGGTCCACTTTCGGTTCTGATGATGAGTGTGAAAAATAACACCCAGGTACTGATAAACT GCCGGAACAACAAGAAGCTTCTGGGGCGGGTGAGGGCATTCGATCGTCACTGCAACATGGTGTTGGAAAATGTAAAGGAGATATGGACTGAGGTGCCCAA GACAGGGAAAGGCAAGAAGAAGGCACAACCAGTGAACAAAGATAGGTTCATCAGTAAGATGTTTCTTCGTGGCGATTCCGTGATTCTTGTACTTAGGAAC CCCAAGTGA
AA sequence Show only first row Show all	>Lus10026556 pacid=23164200 polypeptide=Lus10026556 locus=Lus10026556.g ID=Lus10026556.BGIv1.0 annot-version=v1.0 MEEDVPNKEDEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVKEIWTEVPKTGKGKKKAQPVNKDRFISKMFLRGDSVILVLRN PK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47640			Small nuclear ribonucleoprotei...		Lus10026556 [exp]	0	1
					Lus10029394 [exp]	1.0	0.9339
AT4G33350		AtTic22-IV	translocon at the inner envelo...		Lus10006487 [exp]	4.0	0.9088
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10022881 [exp]	6.0	0.9183
AT4G11080		3xHMG-box1	3xHigh Mobility Group-box1, HM...		Lus10023091 [exp]	6.0	0.9014
AT4G26500		SUFE1, EMB1374,...	SULFUR E 1, MBRYO DEFECTIVE 13...		Lus10026101 [exp]	6.9	0.9119
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	7.3	0.9249
AT3G02080			Ribosomal protein S19e family ...		Lus10021865 [exp]	11.0	0.9014
AT3G02080			Ribosomal protein S19e family ...		Lus10010339 [exp]	11.7	0.8964
AT5G15750			Alpha-L RNA-binding motif/Ribo...		Lus10001767 [exp]	12.8	0.9130
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Lus10008873 [exp]	13.4	0.9195

Compare expression of checked genes

Lus10026556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.