Lus10026749 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27035 118 / 3e-34 AtENODL20 early nodulin-like protein 20 (.1)
AT5G15350 100 / 7e-27 AtENODL17 early nodulin-like protein 17 (.1)
AT4G12880 92 / 2e-24 AtENODL19 early nodulin-like protein 19 (.1.2)
AT3G01070 82 / 7e-20 AtENODL16 early nodulin-like protein 16 (.1)
AT2G23990 66 / 2e-13 AtENODL11 early nodulin-like protein 11 (.1.2)
AT4G30590 64 / 8e-13 AtENODL12 early nodulin-like protein 12 (.1)
AT4G32490 64 / 1e-12 AtENODL4 early nodulin-like protein 4 (.1)
AT2G25060 61 / 9e-12 AtENODL14 early nodulin-like protein 14 (.1)
AT3G27200 59 / 4e-11 Cupredoxin superfamily protein (.1)
AT4G28365 59 / 4e-11 AtENODL3 early nodulin-like protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025535 140 / 5e-40 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10005229 121 / 2e-35 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1)
Lus10025536 114 / 2e-32 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Lus10005231 91 / 4e-23 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1)
Lus10030690 91 / 4e-23 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1)
Lus10026064 80 / 4e-19 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10014356 77 / 4e-18 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1)
Lus10041570 62 / 4e-12 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10018617 61 / 1e-11 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G219900 150 / 1e-46 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1)
Potri.001G219800 137 / 3e-41 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.017G088500 126 / 2e-37 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.017G088600 107 / 9e-30 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.004G121100 96 / 2e-25 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.001G043600 86 / 2e-21 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.003G183300 86 / 2e-21 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.001G332200 62 / 2e-12 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.003G047300 61 / 1e-11 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G074000 58 / 2e-11 AT2G02850 154 / 1e-49 plantacyanin (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10026749 pacid=23176595 polypeptide=Lus10026749 locus=Lus10026749.g ID=Lus10026749.BGIv1.0 annot-version=v1.0
ATGATAGCGGCGGTGTTGGTCGTGACGATGACGGCTTCGACGGCAACGGCGACGGGGAATGCGACGGCGCCGGTGAAGGAAAGGATGGTATACGTTGGAG
GAGGGAGGGAGACATGGGGGCCTAACCGTAATCTCACTGAGTGGTCGTCTCGCCAACACTTCTACGTTGGTAACTGGCTATATTTCGGGTTTGACAAGAG
CATGTACAGCGTGCTAGAGGTGAACAAGACGAGCTACAAGACATGCAACGAAGCCGGATTCATTCATAACATCACAAGAGGAGGACGCGACGTGTACAAA
CTGAAGAAAGCCAAGAATTACTATTTCATCTCCGGCGGAGGGTTCTGCTTCAGCGGTTTGAAAGTCGCCATCCATGTAGAGAAGCACCCTCCGGCACCTG
CTCCGGCTCCCGCGAAGAACTTTGCTCCGTCGCCGATTTCCACTGCCCATTTGGCTTTTGCTCTTGTTGCAGCTCTTGCCACTGGCCTCTCAACATTAGT
GTTCTAG
AA sequence
>Lus10026749 pacid=23176595 polypeptide=Lus10026749 locus=Lus10026749.g ID=Lus10026749.BGIv1.0 annot-version=v1.0
MIAAVLVVTMTASTATATGNATAPVKERMVYVGGGRETWGPNRNLTEWSSRQHFYVGNWLYFGFDKSMYSVLEVNKTSYKTCNEAGFIHNITRGGRDVYK
LKKAKNYYFISGGGFCFSGLKVAIHVEKHPPAPAPAPAKNFAPSPISTAHLAFALVAALATGLSTLVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10026749 0 1
AT1G50560 CYP705A25 "cytochrome P450, family 705, ... Lus10015706 1.0 0.9098
AT2G15220 Plant basic secretory protein ... Lus10014107 1.4 0.8842
Lus10039943 2.4 0.8385
AT5G13530 KEG KEEP ON GOING, protein kinases... Lus10002621 8.6 0.7246
AT2G48020 Major facilitator superfamily ... Lus10042676 9.9 0.7498
AT5G51490 Plant invertase/pectin methyle... Lus10027203 12.2 0.7931
Lus10037861 12.5 0.8111
AT4G05030 Copper transport protein famil... Lus10039093 13.7 0.7785
AT1G24430 HXXXD-type acyl-transferase fa... Lus10037952 14.0 0.8111
Lus10003272 15.3 0.8111

Lus10026749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.