Lus10026880 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25090 155 / 4e-48 AtENODL13 early nodulin-like protein 13 (.1)
AT2G25060 149 / 1e-45 AtENODL14 early nodulin-like protein 14 (.1)
AT4G31840 140 / 4e-42 AtENODL15 early nodulin-like protein 15 (.1)
AT5G57920 138 / 2e-41 AtENODL10 early nodulin-like protein 10 (.1)
AT4G30590 136 / 2e-40 AtENODL12 early nodulin-like protein 12 (.1)
AT2G23990 130 / 4e-38 AtENODL11 early nodulin-like protein 11 (.1.2)
AT3G20570 116 / 2e-32 AtENODL9 early nodulin-like protein 9 (.1)
AT5G53870 110 / 1e-28 AtENODL1 early nodulin-like protein 1 (.1)
AT3G18590 102 / 4e-27 AtENODL5 early nodulin-like protein 5 (.1)
AT1G48940 97 / 2e-25 AtENODL6 early nodulin-like protein 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003432 238 / 2e-80 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10019955 110 / 2e-30 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1)
Lus10043063 108 / 2e-29 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10011158 104 / 7e-28 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10036257 101 / 3e-27 AT2G25060 110 / 3e-31 early nodulin-like protein 14 (.1)
Lus10009617 95 / 2e-24 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1)
Lus10032111 91 / 4e-23 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10018617 91 / 7e-23 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10039852 89 / 3e-22 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G018200 184 / 1e-59 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.006G264600 181 / 2e-58 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.006G184100 164 / 1e-51 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.001G419200 107 / 6e-29 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.015G052000 100 / 8e-27 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.011G117800 103 / 1e-26 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.011G135400 100 / 3e-26 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.001G398800 100 / 5e-25 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.017G011200 93 / 1e-23 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.001G338800 88 / 7e-22 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10026880 pacid=23142896 polypeptide=Lus10026880 locus=Lus10026880.g ID=Lus10026880.BGIv1.0 annot-version=v1.0
ATGGCGGCCTCTCACAGAGCTCTGCTTTCTTCTTCCAGCTGCTGCTGCCTCCTTATAATCCTATTCAGCTACTCCTCACAATTCGCCGCCGCCAAAGAGC
TACTAGTGGGCGGGAAGACCGACGCCTGGACGGTTCCATCTTCCGAATCCGATTCCCTCAACAAATGGGCCCAAAACACCCGCTTCCGTATCGGCGACTC
TCTCGTGTGGAAGTACGACGGTACAAAGGACTCGGTGATGCAAGTGAGCAGGAAAGCTTACCTGGGATGCAACACAACAGAGCCAATAGCGGAGTACAAA
GACGGGGAAACCAAAGTGAAGCTGGACAGATCAGGTGCTTTCTACTTCATCAGTGGAGCCGAGGGACATTGCAAGCAAGGTCAGAAGGTCATCGTCGTTG
TCTTGTCTTCCAGGAAGAAGAAGCCTGTTTCTTTTTCACCTGCTCCTGCTCCTTCTCCTTCTGATGCTATGGCTCCTGCTGTTGCTCCCGCCAGCGGCGG
CGCTTCTTCAAGATTCGATCTTGCTGCTGTTAGTGCTCTGTTGTCGGGGTTGGGTCTTGTGGGTTTGCACTGGTTGCTGTTCTGA
AA sequence
>Lus10026880 pacid=23142896 polypeptide=Lus10026880 locus=Lus10026880.g ID=Lus10026880.BGIv1.0 annot-version=v1.0
MAASHRALLSSSSCCCLLIILFSYSSQFAAAKELLVGGKTDAWTVPSSESDSLNKWAQNTRFRIGDSLVWKYDGTKDSVMQVSRKAYLGCNTTEPIAEYK
DGETKVKLDRSGAFYFISGAEGHCKQGQKVIVVVLSSRKKKPVSFSPAPAPSPSDAMAPAVAPASGGASSRFDLAAVSALLSGLGLVGLHWLLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25090 AtENODL13 early nodulin-like protein 13 ... Lus10026880 0 1
AT1G50240 FU FUSED, Protein kinase family p... Lus10039168 2.0 0.9575
AT1G16630 unknown protein Lus10006845 2.6 0.9724
AT4G14330 P-loop containing nucleoside t... Lus10021167 3.5 0.9624
AT1G11800 endonuclease/exonuclease/phosp... Lus10020021 3.7 0.9457
AT5G01910 unknown protein Lus10022734 4.6 0.9505
AT5G58930 Protein of unknown function (D... Lus10018206 5.1 0.9458
AT5G43020 Leucine-rich repeat protein ki... Lus10024803 5.5 0.9467
AT1G26760 SDG35, ATXR1 SET domain protein 35 (.1) Lus10037155 6.0 0.9586
AT2G23530 Zinc-finger domain of monoamin... Lus10000845 6.9 0.9521
AT3G54400 Eukaryotic aspartyl protease f... Lus10024148 8.1 0.9278

Lus10026880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.