Lus10027043 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72230 99 / 4e-26 Cupredoxin superfamily protein (.1)
AT2G32300 100 / 6e-26 UCC1 uclacyanin 1 (.1)
AT3G60270 97 / 2e-25 Cupredoxin superfamily protein (.1)
AT2G44790 96 / 8e-25 UCC2 uclacyanin 2 (.1)
AT3G60280 94 / 1e-23 UCC3 uclacyanin 3 (.1)
AT3G27200 92 / 2e-23 Cupredoxin superfamily protein (.1)
AT1G22480 85 / 8e-21 Cupredoxin superfamily protein (.1)
AT2G26720 84 / 3e-20 Cupredoxin superfamily protein (.1)
AT5G07475 84 / 4e-20 Cupredoxin superfamily protein (.1)
AT2G31050 81 / 7e-19 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025580 244 / 5e-83 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10020944 111 / 9e-31 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10008720 109 / 5e-30 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10027143 104 / 1e-27 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10007026 89 / 2e-22 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10041570 89 / 3e-22 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10007028 89 / 4e-22 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10022350 88 / 8e-22 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10006680 87 / 3e-21 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G101300 117 / 5e-33 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 115 / 7e-32 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.014G049600 107 / 2e-29 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.007G120200 92 / 7e-23 AT2G32300 118 / 3e-32 uclacyanin 1 (.1)
Potri.001G080700 89 / 2e-22 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.003G047300 90 / 4e-22 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G161300 87 / 1e-21 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.001G332200 86 / 3e-21 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.003G150300 85 / 9e-21 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.006G259000 83 / 4e-20 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10027043 pacid=23151536 polypeptide=Lus10027043 locus=Lus10027043.g ID=Lus10027043.BGIv1.0 annot-version=v1.0
ATGGCCATCTTTGCCGCTCTCGCAATCCTCCTGATCGCCACTCCGGCTGCCCACGCCGCTGACATCGTCATCGGTGGTTCCAGTGGCTGGACTAATTTTG
GCGTCGACTACGACTCATGGTCTGCCGGTCAGAAATTTAAAGTCGGTGATAATGCTGTGTTCAACTATGGCGGAAGCCACAGTGTGGCAGAAGTGTCAAG
TAGCGATTACAATAGCTGCGACGCCAGCAACGCCATCCAGACCCACAGCGACGGAGCCACCAAAATCCCTCTAAAAACCGCCGGCACTAAGTACTTCATC
TGCACTGCCGCCGGCCACTGCAGCAGCGGCATGAAGGTGTCAATTAAAGTCGATGAGGCCAGCAGCGGTGGGTCCCCCAGCACCCCAACTCCCACTACTC
CATCGGGATCAGGATCAGGATCCGGGTCCACCACGCCGTCCGATTCTGAGCCTTCTACCCCAGCATCCAGCTCCGGCGGGTCGAACAAGAAGGAGCCATC
TTATAACACCGGTGCCGCCACTTCCTCCGTCCTCTACAACGTGGTGTTTGGTTCAGCTGCAGTGATTGGAACCACCATGGTTGCACTTTTGGGCTAG
AA sequence
>Lus10027043 pacid=23151536 polypeptide=Lus10027043 locus=Lus10027043.g ID=Lus10027043.BGIv1.0 annot-version=v1.0
MAIFAALAILLIATPAAHAADIVIGGSSGWTNFGVDYDSWSAGQKFKVGDNAVFNYGGSHSVAEVSSSDYNSCDASNAIQTHSDGATKIPLKTAGTKYFI
CTAAGHCSSGMKVSIKVDEASSGGSPSTPTPTTPSGSGSGSGSTTPSDSEPSTPASSSGGSNKKEPSYNTGAATSSVLYNVVFGSAAVIGTTMVALLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72230 Cupredoxin superfamily protein... Lus10027043 0 1
AT4G30170 Peroxidase family protein (.1) Lus10001442 1.0 0.9687
AT1G55210 Disease resistance-responsive ... Lus10017228 2.4 0.9569
AT2G03760 AtSOT12, AtSOT1... ARABIDOPSIS THALIANA SULFOTRAN... Lus10031623 3.5 0.9530
AT1G77330 2-oxoglutarate (2OG) and Fe(II... Lus10000857 3.5 0.9389
AT1G06290 ATACX3, ACX3 acyl-CoA oxidase 3 (.1) Lus10016249 3.9 0.9552
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10008097 3.9 0.9441
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10033898 6.7 0.9252
Lus10033372 7.1 0.9199
AT5G56040 Leucine-rich receptor-like pro... Lus10032954 8.8 0.9375
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10021103 9.9 0.9356

Lus10027043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.