Lus10027143 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32300 129 / 2e-36 UCC1 uclacyanin 1 (.1)
AT5G07475 102 / 9e-27 Cupredoxin superfamily protein (.1)
AT3G27200 100 / 4e-26 Cupredoxin superfamily protein (.1)
AT3G60270 99 / 1e-25 Cupredoxin superfamily protein (.1)
AT2G31050 91 / 1e-22 Cupredoxin superfamily protein (.1)
AT2G26720 90 / 5e-22 Cupredoxin superfamily protein (.1)
AT5G26330 86 / 2e-20 Cupredoxin superfamily protein (.1)
AT2G44790 83 / 2e-19 UCC2 uclacyanin 2 (.1)
AT1G72230 79 / 3e-18 Cupredoxin superfamily protein (.1)
AT2G25060 78 / 9e-18 AtENODL14 early nodulin-like protein 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039699 113 / 3e-30 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10025580 109 / 1e-29 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10027043 104 / 1e-27 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10020944 95 / 4e-24 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10008720 94 / 1e-23 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10012085 93 / 2e-23 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10041211 92 / 6e-23 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10010533 91 / 2e-22 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10022350 89 / 6e-22 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120200 153 / 4e-46 AT2G32300 118 / 3e-32 uclacyanin 1 (.1)
Potri.003G150300 110 / 2e-30 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.001G080700 110 / 3e-30 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.014G049600 100 / 3e-26 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.002G101300 92 / 4e-23 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.001G332200 90 / 2e-22 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.006G259000 90 / 3e-22 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.006G259101 89 / 4e-22 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.002G101200 90 / 8e-22 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.002G161300 88 / 8e-22 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10027143 pacid=23145449 polypeptide=Lus10027143 locus=Lus10027143.g ID=Lus10027143.BGIv1.0 annot-version=v1.0
ATGATCGTGTCGGCGACAATATCAATGGCTCTCCTCAATTCATCAGCCATGGCCGCGAACTACATCGTCGGAGGCCCAAACGGCGGATGGGACGCCACCA
CCGATCTCCAAACATGGGCCGCTTCCCAGTCTTTCCAACCCGGAGACAACCTCATTTTCCAGTACGCTCCAAGTCATGACGTGGTGGAAGTCCCGAAATC
CGACTACGACGCCTGCCAGGCGACGACTCCGATTCAATCCTACACCGGCGGCGCTTCCATCGTTCCGATCACTTCCGCTGGAAAAAGGTACTTCATCTGC
GGGACTCCTGGACATTGCAGTTCAGGGATGAAGCTCGAAGTCAACATTGTTTCAACCATTTCCCCTGCCTCCCCTGCCTCTGCGCCAGAGCAATCTCTAT
CTCCTGCCTTGTCTCTGCCTTTCCCCACCGTTGAATCACCAGCGGCGGAATTTCCACCATCTTCAGTGTCTGCGTCGCCTCTTCCGTCGCCGGAGCTGGA
AATTCCGGTTCTGGGAAGCTCTCCTGCATTGTCTCCGTTTCCGACGGGTACCTCTGCTCTGACTCCGCCGTCTGTGGATTCGTCGTCAGCTGAGGGAAAT
GGGTTCGGCTCGATTCAGGGGATTGTCGTCGGATTGTGTTCGTTAGTAGCGGCTGTGATTGTGGTGATGGGTTGA
AA sequence
>Lus10027143 pacid=23145449 polypeptide=Lus10027143 locus=Lus10027143.g ID=Lus10027143.BGIv1.0 annot-version=v1.0
MIVSATISMALLNSSAMAANYIVGGPNGGWDATTDLQTWAASQSFQPGDNLIFQYAPSHDVVEVPKSDYDACQATTPIQSYTGGASIVPITSAGKRYFIC
GTPGHCSSGMKLEVNIVSTISPASPASAPEQSLSPALSLPFPTVESPAAEFPPSSVSASPLPSPELEIPVLGSSPALSPFPTGTSALTPPSVDSSSAEGN
GFGSIQGIVVGLCSLVAAVIVVMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32300 UCC1 uclacyanin 1 (.1) Lus10027143 0 1
AT3G57040 ATRR4, ARR9 RESPONSE REGULATOR 4, response... Lus10039524 1.7 0.9072
AT5G15290 CASP5 Casparian strip membrane domai... Lus10015375 2.2 0.9229
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016212 2.8 0.8980
AT3G11550 CASP2 Casparian strip membrane domai... Lus10004205 3.7 0.9203
AT5G45800 MEE62 maternal effect embryo arrest ... Lus10029235 7.1 0.8570
AT1G19230 Riboflavin synthase-like super... Lus10034890 7.3 0.8885
AT5G61240 Leucine-rich repeat (LRR) fami... Lus10004662 8.5 0.8346
AT1G54120 unknown protein Lus10008114 8.9 0.8562
AT5G47520 AtRABA5a RAB GTPase homolog A5A (.1) Lus10017558 10.8 0.8332
AT5G47950 HXXXD-type acyl-transferase fa... Lus10002893 15.0 0.8879

Lus10027143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.