Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02840 172 / 7e-57 Small nuclear ribonucleoprotein family protein (.1.2) AT3G07590 170 / 3e-56 Small nuclear ribonucleoprotein family protein (.1.2) AT1G20580 50 / 9e-09 Small nuclear ribonucleoprotein family protein (.1) AT1G76300 47 / 1e-07 SMD3 snRNP core protein SMD3 (.1) AT5G27720 44 / 2e-06 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT1G03330 39 / 7e-05 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003727 [exp] 179 / 8e-59 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2) Lus10025186 [exp] 164 / 5e-54 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10016068 [exp] 164 / 5e-54 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013227 [exp] 49 / 3e-08 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10030747 [exp] 49 / 3e-08 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10016013 [exp] 49 / 4e-08 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10012263 [exp] 49 / 4e-08 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 43 / 2e-05 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10004221 [exp] 42 / 2e-05 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G054800 [exp] 174 / 9e-58 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2) Potri.005G207900 [exp] 162 / 2e-53 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G010200 [exp] 50 / 7e-09 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1) Potri.005G251100 [exp] 49 / 2e-08 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1) Potri.002G205700 [exp] 44 / 3e-06 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 42 / 1e-05 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.004G219000 [exp] 38 / 0.0002 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.003G014900 [exp] 38 / 0.0002 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10028022 pacid=23181202 polypeptide=Lus10028022 locus=Lus10028022.g ID=Lus10028022.BGIv1.0 annot-version=v1.0 ATGAAGCTCGTCAGGTTTTTGATGAAGTTGAACAACGAGACCGTTTCGATTGAGCTCAAGAATGGGACCGTTGTTCATGGCACCATTATAGGTGTGGACA TAAGCATGAACACTCATCTGAAAACGGTGAAATTAACACTGAAAGGGAAGAATCCAGTAACTCTAGACCATCTCAGTGTTAGAGGCAATAACATCCGGTA TTACATCCTTCCTGACAGCTTGAATCTCGAGACATTGCTGGTCGAAGAGACGCCCAAGATCAAACCAAAGAAGGCAGTTGCTGGAAGGGCTGTGGGTCGT GGACGAGGTCGTGGCCGTGGACGAGGACGTGGTCGGGGACGTTAG
AA sequence Show only first row Show all	>Lus10028022 pacid=23181202 polypeptide=Lus10028022 locus=Lus10028022.g ID=Lus10028022.BGIv1.0 annot-version=v1.0 MKLVRFLMKLNNETVSIELKNGTVVHGTIIGVDISMNTHLKTVKLTLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPKIKPKKAVAGRAVGR GRGRGRGRGRGRGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07590			Small nuclear ribonucleoprotei...		Lus10028022 [exp]	0	1
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Lus10011877 [exp]	2.4	0.8972
AT3G07590			Small nuclear ribonucleoprotei...		Lus10003727 [exp]	3.5	0.9034
AT5G13340			unknown protein		Lus10035960 [exp]	5.0	0.8852
AT4G13720			Inosine triphosphate pyrophosp...		Lus10011757 [exp]	5.3	0.8814
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10000651 [exp]	5.7	0.8709
AT1G65700			Small nuclear ribonucleoprotei...		Lus10028183 [exp]	7.5	0.8320
AT5G42820	C3HZnF	ATU2AF35B	Zinc finger C-x8-C-x5-C-x3-H t...		Lus10002845 [exp]	8.0	0.8853
AT5G18540			unknown protein		Lus10033960 [exp]	9.7	0.8357
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10041194 [exp]	10.4	0.8844
AT5G05210			Surfeit locus protein 6 (.1.2)		Lus10023712 [exp]	11.0	0.8811

Compare expression of checked genes

Lus10028022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.