Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G44830 92 / 4e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 89 / 9e-23 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT1G77640 89 / 2e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G19210 78 / 1e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G50260 76 / 2e-18 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT4G16750 76 / 4e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 76 / 1e-17 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT4G36900 75 / 1e-17 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT2G23340 74 / 4e-17 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT5G67190 73 / 8e-17 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003740 [exp] 137 / 9e-42 AT1G21910 130 / 4e-38 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 76 / 2e-18 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10011123 [exp] 76 / 8e-18 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 74 / 5e-17 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 74 / 6e-17 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 71 / 1e-16 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 72 / 2e-16 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 71 / 2e-16 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10009373 [exp] 71 / 4e-16 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G176000 [exp] 102 / 7e-28 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Potri.002G085600 [exp] 98 / 4e-26 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 77 / 5e-18 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 75 / 8e-18 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.003G054100 [exp] 74 / 2e-17 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 74 / 3e-17 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.007G046500 [exp] 74 / 4e-17 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.006G138900 [exp] 73 / 4e-17 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 74 / 5e-17 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 74 / 6e-17 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10028032 pacid=23181233 polypeptide=Lus10028032 locus=Lus10028032.g ID=Lus10028032.BGIv1.0 annot-version=v1.0 ATGGTGAAGACGGATGATCATCAAGCTCCAGAGAACAACAACAACATGGTCAACAAGAGTACTACCAAGAACAAGTCGTCAATTATGGTGAAGAAGTTCA AAGGAGTGAGAATGAGAAGCTGGGGCTCTTGGGTTTCTGAGATCCGCGCTCCCAACCAAAAAACCAGAATCTGGCTCGGTTCTTACTCCACCCCGGAAGC CGCCGCCCGAGCCTACGACGCCGCCCTTCTCTGCCTCAAAGGCTCCGCCGCCGCCGCCCCCACTCTCAACTTCCCCACCTCTTCCTACGCCCATTACTAC ACCTACACCTCCTCCGCCGCCCCCATGTCCCCCAAGTCCATCCCCACCCCCAACACCCACCCCGCGGCCCCCCCCCCCCCCCGCCGCCAATGCCAACACT ACTGA
AA sequence Show only first row Show all	>Lus10028032 pacid=23181233 polypeptide=Lus10028032 locus=Lus10028032.g ID=Lus10028032.BGIv1.0 annot-version=v1.0 MVKTDDHQAPENNNNMVNKSTTKNKSSIMVKKFKGVRMRSWGSWVSEIRAPNQKTRIWLGSYSTPEAAARAYDAALLCLKGSAAAAPTLNFPTSSYAHYY TYTSSAAPMSPKSIPTPNTHPAAPPPPRRQCQHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Lus10028032 [exp]	0	1
AT3G19680			Protein of unknown function (D...		Lus10012451 [exp]	1.7	0.8313
AT4G19230		CYP707A1	"cytochrome P450, family 707, ...		Lus10035685 [exp]	3.2	0.7905
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Lus10003740 [exp]	7.1	0.7648
AT4G26690		GDPDL3, GPDL2, ...	SHAVEN 3, MUTANT ROOT HAIR 5, ...		Lus10016584 [exp]	7.5	0.7520
AT1G75080	BZR	BZR1	BRASSINAZOLE-RESISTANT 1, Bras...		Lus10010795 [exp]	7.7	0.7193
AT4G25315			Expressed protein (.1.2)		Lus10014065 [exp]	8.9	0.7043
AT5G38700			unknown protein		Lus10010019 [exp]	14.4	0.7153
AT5G03160		ATP58IPK	homolog of mamallian P58IPK (....		Lus10026498 [exp]	14.5	0.6596
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10033902 [exp]	15.3	0.7470
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10003549 [exp]	15.5	0.7440

Compare expression of checked genes

Lus10028032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.