Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21120 150 / 5e-43 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) AT2G34960 137 / 4e-38 CAT5 cationic amino acid transporter 5 (.1) AT1G17120 124 / 3e-33 CAT8 cationic amino acid transporter 8 (.1) AT3G10600 72 / 3e-15 CAT7 cationic amino acid transporter 7 (.1) AT5G04770 71 / 2e-14 CAT6, ATCAT6 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) AT5G36940 62 / 1e-11 CAT3 cationic amino acid transporter 3 (.1) AT1G58030 56 / 1e-09 CAT2 cationic amino acid transporter 2 (.1) AT1G05940 55 / 3e-09 CAT9 cationic amino acid transporter 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042817 [exp] 255 / 1e-82 AT4G21120 731 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10001581 [exp] 142 / 2e-39 AT4G21120 915 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10023271 [exp] 140 / 4e-39 AT4G21120 902 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10003697 [exp] 123 / 3e-33 AT4G21120 416 / 2e-140 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10005574 [exp] 119 / 1e-31 AT1G17120 811 / 0.0 cationic amino acid transporter 8 (.1) Lus10000962 [exp] 80 / 1e-17 AT5G04770 543 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Lus10040142 [exp] 80 / 1e-17 AT5G04770 547 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Lus10028195 [exp] 61 / 4e-11 AT1G05940 763 / 0.0 cationic amino acid transporter 9 (.1) Lus10042898 [exp] 61 / 5e-11 AT1G05940 763 / 0.0 cationic amino acid transporter 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G133100 [exp] 140 / 2e-39 AT4G21120 845 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.003G154600 [exp] 140 / 4e-39 AT2G34960 870 / 0.0 cationic amino acid transporter 5 (.1) Potri.012G131300 [exp] 139 / 1e-38 AT4G21120 848 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.013G030900 [exp] 134 / 5e-37 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.013G030833 [exp] 134 / 5e-37 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.001G378500 [exp] 120 / 6e-32 AT1G17120 785 / 0.0 cationic amino acid transporter 8 (.1) Potri.003G083700 [exp] 79 / 2e-17 AT5G04770 509 / 7e-176 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Potri.001G150700 [exp] 76 / 2e-16 AT5G04770 519 / 2e-179 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Potri.008G017100 [exp] 76 / 3e-16 AT3G10600 778 / 0.0 cationic amino acid transporter 7 (.1) Potri.010G241000 [exp] 74 / 1e-15 AT3G10600 781 / 0.0 cationic amino acid transporter 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0062 [flax] [poplar] APC PF00324 [flax] [poplar] AA_permease Amino acid permease
Representative CDS sequence Show only first row Show all	>Lus10028116 pacid=23166562 polypeptide=Lus10028116 locus=Lus10028116.g ID=Lus10028116.BGIv1.0 annot-version=v1.0 ATGACAGTAGTAATCATTTTTTACTGTTCTTTAGCAGCATGCCTCACATTGATGCAGAGTTACACCCAGATCAATACAGATGCTGCTTTCTCTATAGCAT TCAAATCCGCAGGGATGGATTGGACGAAATACATAGTAGCATTCGGTGCTTTGAAAGGAATGACGACTGTTCTTCTTGCTAATGTCATTGCACAATCTCG ATACTTCACTCATATAAGCCGTATACACATGGCTCCGCCTGTTCTTGCTTACATTAATGCCAGAACTGGGACTCCGTTGGTGGCCACTGTTGTGATGACG GTAGCGAATTCGATCGTGGCATTCTTTACGAGCTTGGACGTTCTGTCGAATCTTCTGTCGATTTCTACGTTGTTTATTTTCTCGCTGGTGGCTCTGGCGC TTCTGGTTAGGAGGTACTATCTGGCCGGGGAGACTAAGGGTTTTTCGGATGAGTGGAAGCTGGTTTTCTTTCTGGTTTTGATTGTGGGATCTTCTTGTGG GACAAGTGCTTAA
AA sequence Show only first row Show all	>Lus10028116 pacid=23166562 polypeptide=Lus10028116 locus=Lus10028116.g ID=Lus10028116.BGIv1.0 annot-version=v1.0 MTVVIIFYCSLAACLTLMQSYTQINTDAAFSIAFKSAGMDWTKYIVAFGALKGMTTVLLANVIAQSRYFTHISRIHMAPPVLAYINARTGTPLVATVVMT VANSIVAFFTSLDVLSNLLSISTLFIFSLVALALLVRRYYLAGETKGFSDEWKLVFFLVLIVGSSCGTSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10028116 [exp]	0	1
AT5G61340			unknown protein		Lus10003483 [exp]	1.4	0.8829
AT4G12140			RING/U-box superfamily protein...		Lus10007628 [exp]	1.4	0.8576
AT1G03390			HXXXD-type acyl-transferase fa...		Lus10017744 [exp]	9.7	0.7847
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10028979 [exp]	13.0	0.7990
AT1G67950			RNA-binding (RRM/RBD/RNP motif...		Lus10034580 [exp]	14.2	0.8178
AT1G64090		RTNLB3	Reticulan like protein B3 (.1....		Lus10013099 [exp]	16.9	0.7215
AT1G59720		CRR28	CHLORORESPIRATORY REDUCTION28,...		Lus10036422 [exp]	18.4	0.7532
AT3G15670			Late embryogenesis abundant pr...		Lus10004395 [exp]	19.3	0.8507
AT4G18840			Pentatricopeptide repeat (PPR-...		Lus10036420 [exp]	20.0	0.8244
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10033882 [exp]	25.5	0.8185

Compare expression of checked genes

Lus10028116 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.