Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65700 155 / 6e-51 Small nuclear ribonucleoprotein family protein (.1.2.3) AT1G19120 49 / 2e-08 Small nuclear ribonucleoprotein family protein (.1) AT3G14080 47 / 8e-08 Small nuclear ribonucleoprotein family protein (.1.2) AT2G03870 40 / 3e-05 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042884 [exp] 206 / 5e-71 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10035639 [exp] 42 / 3e-06 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10008124 [exp] 42 / 8e-06 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10017019 [exp] 36 / 0.0006 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G278000 [exp] 163 / 6e-54 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.003G068400 [exp] 41 / 2e-05 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 41 / 2e-05 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G269500 [exp] 40 / 2e-05 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 40 / 2e-05 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10028183 pacid=23166396 polypeptide=Lus10028183 locus=Lus10028183.g ID=Lus10028183.BGIv1.0 annot-version=v1.0 ATGGCTTCCGGTCTTGGACTCGAATCTCTTGTTGACCAAACCATTTCTGTGATCACAAATGATGGCCGCAACATAGTGGGCAACTTGAAAGGCTTCGATC AGGCCACTAATATCATCCTCGATGAATCCCATGAACGTGTTTACTCCACCAAGGAAGGCGTGCAACAACTGGTTTTGGGCTTGTACATAATAAGGGTTTG CTCCTTCTTCCAATGTTACAGAAGCGTGATTGGGGAGCTTGACGAGGAACTTGATGCGCAGCTTGATATGTCGAATCTCAGAGCACATCCCCTCAAACCT GTGATTCATTGA
AA sequence Show only first row Show all	>Lus10028183 pacid=23166396 polypeptide=Lus10028183 locus=Lus10028183.g ID=Lus10028183.BGIv1.0 annot-version=v1.0 MASGLGLESLVDQTISVITNDGRNIVGNLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRVCSFFQCYRSVIGELDEELDAQLDMSNLRAHPLKP VIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65700			Small nuclear ribonucleoprotei...		Lus10028183 [exp]	0	1
AT5G03670			unknown protein		Lus10027723 [exp]	2.4	0.8303
AT4G00850		GIF3	GRF1-interacting factor 3 (.1)		Lus10032892 [exp]	5.7	0.8253
AT3G07590			Small nuclear ribonucleoprotei...		Lus10028022 [exp]	7.5	0.8320
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10017771 [exp]	15.2	0.7701
AT1G31220			Formyl transferase (.1)		Lus10013428 [exp]	20.7	0.8208
AT5G10510	AP2_ERF	PLT3, AIL6	PLETHORA 3, AINTEGUMENTA-like ...		Lus10012728 [exp]	22.4	0.8215
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10021405 [exp]	23.8	0.8025
AT3G24150			unknown protein		Lus10019404 [exp]	28.4	0.7764
AT5G66240			Transducin/WD40 repeat-like su...		Lus10017157 [exp]	28.5	0.7816
AT3G07590			Small nuclear ribonucleoprotei...		Lus10003727 [exp]	29.9	0.8175

Compare expression of checked genes

Lus10028183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.