Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 107 / 2e-31 ARPN plantacyanin (.1) AT1G17800 77 / 6e-19 AtENODL22 early nodulin-like protein 22 (.1) AT3G17675 69 / 1e-16 Cupredoxin superfamily protein (.1) AT2G31050 72 / 2e-16 Cupredoxin superfamily protein (.1) AT3G60270 69 / 1e-15 Cupredoxin superfamily protein (.1) AT5G26330 66 / 2e-14 Cupredoxin superfamily protein (.1) AT2G26720 65 / 5e-14 Cupredoxin superfamily protein (.1) AT2G32300 66 / 6e-14 UCC1 uclacyanin 1 (.1) AT3G27200 64 / 1e-13 Cupredoxin superfamily protein (.1) AT1G45063 64 / 2e-13 copper ion binding;electron carriers (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028396 [exp] 171 / 4e-56 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10041850 [exp] 122 / 3e-37 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10041849 [exp] 120 / 3e-36 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10018938 [exp] 111 / 1e-32 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10028640 [exp] 109 / 5e-32 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 109 / 5e-32 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10041848 [exp] 108 / 1e-31 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10022800 [exp] 88 / 2e-23 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10011867 [exp] 85 / 3e-20 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G074000 [exp] 106 / 7e-31 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.002G241500 [exp] 103 / 1e-29 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.001G209300 [exp] 97 / 3e-27 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.007G104600 [exp] 78 / 2e-19 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.013G061300 [exp] 75 / 3e-18 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.009G136200 [exp] 74 / 2e-17 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 72 / 2e-16 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 70 / 5e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030450 [exp] 69 / 6e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 69 / 1e-15 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10028395 pacid=23165975 polypeptide=Lus10028395 locus=Lus10028395.g ID=Lus10028395.BGIv1.0 annot-version=v1.0 ATGGTACTGCTGATCGTCATCGTGTCTTTTCAGTCGAAGACTACCGACGCCACCTCCTTTCTCGTCGGCGATGATGACGGTTGGGGGTTGAAAGCTGGCA ATTGGGCTCAGGGAATGAATTTGCGTGCCGGCGACACACTTATTTTCAAGTACGACCCGGATAAATACAACGTGGTGGCCGTTGACAGTGAGGAAACTTA CAATAACTGCAAAACTCCGCCGGGGGCATCGATATACGATTCCGGCGAAGACTATATACCACTTGAGAAAGGCATCAACTATTTCATATGTAACTTGCCT GGCATGTGTACAGCTGGCGTCAGAATGGCCGTCAATGCTGCTTTTTAA
AA sequence Show only first row Show all	>Lus10028395 pacid=23165975 polypeptide=Lus10028395 locus=Lus10028395.g ID=Lus10028395.BGIv1.0 annot-version=v1.0 MVLLIVIVSFQSKTTDATSFLVGDDDGWGLKAGNWAQGMNLRAGDTLIFKYDPDKYNVVAVDSEETYNNCKTPPGASIYDSGEDYIPLEKGINYFICNLP GMCTAGVRMAVNAAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02850		ARPN	plantacyanin (.1)		Lus10028395 [exp]	0	1

Compare expression of checked genes

Lus10028395 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.