Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 102 / 7e-29 ARPN plantacyanin (.1) AT5G26330 76 / 4e-18 Cupredoxin superfamily protein (.1) AT1G17800 67 / 7e-15 AtENODL22 early nodulin-like protein 22 (.1) AT3G60270 67 / 2e-14 Cupredoxin superfamily protein (.1) AT2G31050 66 / 3e-14 Cupredoxin superfamily protein (.1) AT3G53330 67 / 4e-14 plastocyanin-like domain-containing protein (.1) AT3G17675 63 / 1e-13 Cupredoxin superfamily protein (.1) AT5G07475 64 / 2e-13 Cupredoxin superfamily protein (.1) AT2G44790 64 / 3e-13 UCC2 uclacyanin 2 (.1) AT1G45063 64 / 3e-13 copper ion binding;electron carriers (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028395 [exp] 160 / 4e-52 AT2G02850 107 / 2e-31 plantacyanin (.1) Lus10041850 [exp] 114 / 2e-33 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10041849 [exp] 110 / 3e-32 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10041848 [exp] 109 / 9e-32 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10018938 [exp] 108 / 2e-31 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10028641 [exp] 106 / 1e-30 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028640 [exp] 106 / 1e-30 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10022800 [exp] 93 / 2e-25 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10011867 [exp] 87 / 1e-20 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G074000 [exp] 104 / 9e-30 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.002G241500 [exp] 99 / 1e-27 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.001G209300 [exp] 92 / 3e-25 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.003G047300 [exp] 79 / 6e-19 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.007G104600 [exp] 74 / 8e-18 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.006G259000 [exp] 73 / 5e-17 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 72 / 7e-17 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 72 / 1e-16 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 72 / 1e-16 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 71 / 2e-16 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10028396 pacid=23166066 polypeptide=Lus10028396 locus=Lus10028396.g ID=Lus10028396.BGIv1.0 annot-version=v1.0 ATGAAGGGTACTGTCTTGTCGATCATAGTGATACTGCTGACCATCATCATGTCTGTTCAGTTGAGGACTACCGACGCAAAGGCCTTCTACGTCGGGGACG ACAGCGGCGGTTGGGGATTGAACATTGGAAATTGGGCTCAGGGAAAGAATTTCCGTTTTGGCGACACACTTGTTTTCAAGTACGACCCAAAGACATACAA CGTCGTGGTAATCGACGGTGAGCAGAATTACAATAACTGCAACACTCCGACGAACGCGGCGACGTACGATTCCGGCGAAGATGCTATCATACTTCAGAAA GGAATGAACTATTTCATATGTAACTTGCCCGGCATGTGTACCGCTGGCGTCAGAATGGCTGTCAATGGTGCTTATGGAATTTAA
AA sequence Show only first row Show all	>Lus10028396 pacid=23166066 polypeptide=Lus10028396 locus=Lus10028396.g ID=Lus10028396.BGIv1.0 annot-version=v1.0 MKGTVLSIIVILLTIIMSVQLRTTDAKAFYVGDDSGGWGLNIGNWAQGKNFRFGDTLVFKYDPKTYNVVVIDGEQNYNNCNTPTNAATYDSGEDAIILQK GMNYFICNLPGMCTAGVRMAVNGAYGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02850		ARPN	plantacyanin (.1)		Lus10028396 [exp]	0	1
					Lus10000351 [exp]	3.0	1.0000
					Lus10002886 [exp]	4.2	1.0000
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	5.2	1.0000
					Lus10014748 [exp]	6.0	1.0000
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	6.7	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	7.3	1.0000
AT5G58660			2-oxoglutarate (2OG) and Fe(II...		Lus10031865 [exp]	7.4	1.0000
					Lus10023108 [exp]	7.9	1.0000
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	8.5	1.0000
					Lus10024321 [exp]	9.0	1.0000

Compare expression of checked genes

Lus10028396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.