Lus10029314 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 128 / 6e-37 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 105 / 1e-27 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 103 / 5e-27 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT5G13330 97 / 5e-25 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT3G23240 93 / 2e-23 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT2G33710 93 / 3e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT3G23230 90 / 5e-23 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT5G51190 92 / 9e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G43410 88 / 3e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G61600 90 / 7e-22 AP2_ERF ERF104 ethylene response factor 104 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016227 296 / 6e-103 AT2G44840 134 / 3e-39 ethylene-responsive element binding factor 13 (.1)
Lus10029334 178 / 1e-56 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Lus10016225 174 / 7e-55 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016210 174 / 7e-55 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029333 172 / 4e-54 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016211 169 / 8e-53 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10016209 164 / 4e-51 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016223 139 / 2e-41 AT2G44840 144 / 1e-43 ethylene-responsive element binding factor 13 (.1)
Lus10016224 138 / 9e-41 AT2G44840 143 / 1e-42 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 140 / 2e-41 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 135 / 2e-39 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 131 / 2e-38 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 120 / 5e-35 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 121 / 3e-34 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 115 / 1e-31 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 113 / 1e-30 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 107 / 3e-28 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 106 / 7e-28 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 102 / 2e-27 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10029314 pacid=23139983 polypeptide=Lus10029314 locus=Lus10029314.g ID=Lus10029314.BGIv1.0 annot-version=v1.0
ATGTCTAGCGAGAATATTCAAGCCCTTGAATTCATCCGCAGTCAACTTCTGGACGACGATAAAGATTCCAGTCGTCTCAACTCTAATGAGGCGCCGTTTT
ACCCTGGCTGCCTTGAGAACGAGAGTTGGAGCGACATTTTGGCCCGACTGGCTGTTGAAGAAAACTCTGCTGCTTCTGTACAGCAACCTGACATTATTGA
TATCGACGACGACCACGACGAAGACGAAGAAGATGGGAATGCTAATAAGAAGCCGAAAGTGGCGCCGGCGCCGGCGCCAAATGTTAAGGCGCGTAATTAC
TTGGGAGTCAGGAGAAGGCCGTGGGGGAAGTACGCGGCGGAGATTAGGAATCCGAAGCGAAACGGTGCCAGGAATTGGTTGGGCACTTACGAGTGCCCGG
AAGATGCGGCTCTGGCTTACGATAGAGCTGCTTTTGAGATGAGGGGAGCTAAGGCTAAACTCAACTTCCCGCATTTGGTGGGGTCTGATTTCGAACCAGT
TAGAGTGACTCACAAAAAGCGTGGTTTGCCAAGCCTGCAGCCAACACCATCCACCTCTTCCTCGCTGATGTGCGACTACTCGTCCTACGTGGAAGAGGAC
TGGAACCAGTCCAATGCTATTTGGCAGTGA
AA sequence
>Lus10029314 pacid=23139983 polypeptide=Lus10029314 locus=Lus10029314.g ID=Lus10029314.BGIv1.0 annot-version=v1.0
MSSENIQALEFIRSQLLDDDKDSSRLNSNEAPFYPGCLENESWSDILARLAVEENSAASVQQPDIIDIDDDHDEDEEDGNANKKPKVAPAPAPNVKARNY
LGVRRRPWGKYAAEIRNPKRNGARNWLGTYECPEDAALAYDRAAFEMRGAKAKLNFPHLVGSDFEPVRVTHKKRGLPSLQPTPSTSSSLMCDYSSYVEED
WNQSNAIWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029314 0 1
AT1G07020 unknown protein Lus10026396 1.0 0.7732
AT5G52790 CBS domain-containing protein ... Lus10027528 5.5 0.6639
Lus10022893 11.8 0.6517
AT4G35210 Arabidopsis protein of unknown... Lus10023951 15.0 0.6910
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10027305 19.2 0.5975
AT1G60630 Leucine-rich repeat protein ki... Lus10019429 20.9 0.6493
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001037 28.4 0.5798
AT5G12060 Plant self-incompatibility pro... Lus10023085 30.0 0.5533
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 31.0 0.5533
AT5G18460 Protein of Unknown Function (D... Lus10006861 31.9 0.5533

Lus10029314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.