Lus10029333 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 144 / 3e-43 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT4G17500 121 / 7e-34 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT5G47220 118 / 5e-33 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT3G23240 103 / 2e-27 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT3G23230 101 / 2e-27 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT5G13330 100 / 3e-26 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT2G33710 100 / 3e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT5G43410 96 / 2e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G07580 99 / 4e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G51190 97 / 5e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016211 295 / 1e-102 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10016210 270 / 4e-93 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029334 256 / 1e-87 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Lus10016209 252 / 6e-86 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016225 243 / 3e-82 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029314 187 / 5e-60 AT2G44840 139 / 6e-41 ethylene-responsive element binding factor 13 (.1)
Lus10016227 181 / 8e-58 AT2G44840 134 / 3e-39 ethylene-responsive element binding factor 13 (.1)
Lus10004011 165 / 2e-51 AT2G44840 132 / 2e-38 ethylene-responsive element binding factor 13 (.1)
Lus10030261 158 / 1e-48 AT2G44840 125 / 1e-35 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 164 / 4e-51 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 149 / 1e-45 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 148 / 8e-45 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 146 / 6e-44 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 129 / 1e-38 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 127 / 3e-36 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 127 / 3e-36 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 120 / 2e-33 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 119 / 5e-33 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 112 / 2e-31 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10029333 pacid=23139807 polypeptide=Lus10029333 locus=Lus10029333.g ID=Lus10029333.BGIv1.0 annot-version=v1.0
ATGTCTACCCAGATTCAATCCCTCGAGTCCATCTGCAACCATCTTTTCGGCGACGACGATTCCGAATCGGCACTCTCGAATGCGACTTCATTTTATTCCG
AGTGTCAGAGCTTCAGCACGCTCCTCGAGGCCGACAGCTGGACCGACATTTTCTCCCAGCTGGATGATGAAGAAATTACTTCTACTAATTGCAAGCCACT
ACCAACAGTAGTGGTGTTGCCGAAGAAGGCGAATTATAAGGGAGTCAGGAGACGGCCGTGGGGGAAGTACGCGGCGGAGATCAGGGATCCAAAGCGGAAC
GGGGCGAGGATATGGTTGGGTACTTACGAGTCTCCCGAGGATGCAGCTCTAGCTTACGACAGAGCCGCTTTCCAGATGCGGGGAGCTAAGGCTAAGCTCA
ATTTCCCGCATCTGGTGGGGTTTACTGATTACGAACCCGTTAGGGTCACCAACAAAAAACGCTGCTCGCCGGAGTCATCATCCTCATTGTCAACGTTTTC
GGGATCGGAAAATGAATCTCCGGAGCCCAAACGAAGGATGAGTTTGCTTGAGTCGTCCTACGTGGAAGATGAGTGGGACCAGTCAAATGCCATTTGGCAG
TGA
AA sequence
>Lus10029333 pacid=23139807 polypeptide=Lus10029333 locus=Lus10029333.g ID=Lus10029333.BGIv1.0 annot-version=v1.0
MSTQIQSLESICNHLFGDDDSESALSNATSFYSECQSFSTLLEADSWTDIFSQLDDEEITSTNCKPLPTVVVLPKKANYKGVRRRPWGKYAAEIRDPKRN
GARIWLGTYESPEDAALAYDRAAFQMRGAKAKLNFPHLVGFTDYEPVRVTNKKRCSPESSSSLSTFSGSENESPEPKRRMSLLESSYVEDEWDQSNAIWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029333 0 1
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10005551 3.2 0.9133
Lus10039759 10.4 0.8921
AT1G49490 Leucine-rich repeat (LRR) fami... Lus10027935 11.6 0.9033
Lus10011995 12.0 0.8809
AT1G76070 unknown protein Lus10021840 12.3 0.8623
AT3G12580 ATHSP70, HSP70 ARABIDOPSIS HEAT SHOCK PROTEIN... Lus10023419 13.1 0.8282
AT5G15430 Plant calmodulin-binding prote... Lus10000209 13.6 0.8977
AT3G02750 Protein phosphatase 2C family ... Lus10022683 15.9 0.8889
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040326 19.0 0.8919
AT4G18380 F-box family protein (.1.2) Lus10013431 20.5 0.8618

Lus10029333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.