Lus10029334 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 147 / 1e-44 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 117 / 2e-32 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 114 / 3e-31 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT3G23240 102 / 4e-27 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT5G61600 102 / 1e-26 AP2_ERF ERF104 ethylene response factor 104 (.1)
AT2G33710 101 / 1e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT5G51190 101 / 1e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G23230 99 / 1e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT5G07580 99 / 3e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G31230 97 / 1e-24 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016209 270 / 8e-93 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10029333 257 / 6e-88 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016210 241 / 1e-81 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016225 236 / 1e-79 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016211 236 / 3e-79 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10029314 184 / 6e-59 AT2G44840 139 / 6e-41 ethylene-responsive element binding factor 13 (.1)
Lus10016227 181 / 5e-58 AT2G44840 134 / 3e-39 ethylene-responsive element binding factor 13 (.1)
Lus10004011 166 / 5e-52 AT2G44840 132 / 2e-38 ethylene-responsive element binding factor 13 (.1)
Lus10030261 161 / 5e-50 AT2G44840 125 / 1e-35 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 165 / 3e-51 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 147 / 1e-44 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 144 / 8e-44 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 143 / 6e-43 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 130 / 3e-39 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 129 / 5e-37 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 127 / 3e-36 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 117 / 3e-32 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 117 / 4e-32 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 110 / 1e-30 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10029334 pacid=23139888 polypeptide=Lus10029334 locus=Lus10029334.g ID=Lus10029334.BGIv1.0 annot-version=v1.0
ATGTCTACCCAGATTGAAGCTCTAGAATGCATCCGCAACCACCTTTTCGACGACCGTTCGGAATCGGGTCTGATCACCTCCAGTGCGACGTCGTTTTATA
CCGAGTGTCTGAGCTTTAGCACGCTCCTCGACACCGATAACTGGAGCGACATTCTGTCCCAGCTGGCCGTTGATGATTCGAATGTGCAAATAGTGAATAA
TGGCGTGGTGTCGAAGGCGAGTTACAAGGGGGTTCGAAGACGGCCGTGGGGGAAATACGCGGCGGAGATCAGGGATCCAAACCGGAACGGGGCGAGGATA
TGGTTGGGAACTTACGAGTCTCCTGAGGATGCCGCTCTTGCTTACGACAGAGCTGCTTTCCAGATGAGGGGAGCTAAGGCTAAGCTCAATTTTCCGCATC
TGATGGGGTCTACTGATTATGAACCCGTTAGAGTGACTAACAAAAAACGCAACTCTCCGGAATCATCATCCTCTGGGGCCTCCTCGGAATCAGAATATGA
ATCCCCGGAGGCCAAACGACGGTTGAGTTTTCTGCTTGAGTCTTATGTGGAAGATGAGTGGGACCAGTCAAATGCCATTTGGCAGTGA
AA sequence
>Lus10029334 pacid=23139888 polypeptide=Lus10029334 locus=Lus10029334.g ID=Lus10029334.BGIv1.0 annot-version=v1.0
MSTQIEALECIRNHLFDDRSESGLITSSATSFYTECLSFSTLLDTDNWSDILSQLAVDDSNVQIVNNGVVSKASYKGVRRRPWGKYAAEIRDPNRNGARI
WLGTYESPEDAALAYDRAAFQMRGAKAKLNFPHLMGSTDYEPVRVTNKKRNSPESSSSGASSESEYESPEAKRRLSFLLESYVEDEWDQSNAIWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029334 0 1
AT2G18170 ATMPK7 MAP kinase 7 (.1) Lus10014283 4.6 0.8455
AT5G67150 HXXXD-type acyl-transferase fa... Lus10041591 6.0 0.8177
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10024074 10.6 0.8351
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10040243 14.1 0.7459
AT1G68690 AtPERK9 proline-rich extensin-like rec... Lus10035071 14.7 0.7790
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10009798 16.0 0.8094
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10030261 19.1 0.8193
AT1G30135 ZIM TIFY5A, JAZ8 jasmonate-zim-domain protein 8... Lus10038506 25.5 0.7880
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10004011 25.8 0.7431
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10041660 27.9 0.7895

Lus10029334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.