Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40260 82 / 2e-19 GARP Homeodomain-like superfamily protein (.1) AT1G14600 78 / 2e-18 GARP Homeodomain-like superfamily protein (.1) AT2G02060 78 / 2e-18 GARP Homeodomain-like superfamily protein (.1) AT2G38300 78 / 5e-18 GARP myb-like HTH transcriptional regulator family protein (.1) AT2G42660 76 / 1e-17 GARP Homeodomain-like superfamily protein (.1) AT4G28610 68 / 2e-14 GARP ATPHR1, PHR1 phosphate starvation response 1 (.1) AT5G42630 66 / 3e-14 GARP KAN4, KANADI4, ATS KANADI 4, ABERRANT TESTA SHAPE, Homeodomain-like superfamily protein (.1.2) AT4G17695 66 / 1e-13 GARP KAN3, KANADI3 KANADI 3, Homeodomain-like superfamily protein (.1) AT5G29000 65 / 2e-13 GARP PHL1 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) AT4G04580 63 / 3e-13 GARP Homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040945 [exp] 81 / 5e-19 AT2G40260 159 / 2e-45 Homeodomain-like superfamily protein (.1) Lus10012239 [exp] 77 / 7e-18 AT2G38300 170 / 3e-50 myb-like HTH transcriptional regulator family protein (.1) Lus10002207 [exp] 77 / 7e-18 AT2G38300 171 / 9e-51 myb-like HTH transcriptional regulator family protein (.1) Lus10001149 [exp] 76 / 1e-17 AT2G40260 119 / 1e-30 Homeodomain-like superfamily protein (.1) Lus10007279 [exp] 73 / 3e-17 AT2G38300 107 / 1e-28 myb-like HTH transcriptional regulator family protein (.1) Lus10029225 [exp] 71 / 4e-16 AT2G38300 110 / 5e-30 myb-like HTH transcriptional regulator family protein (.1) Lus10007513 [exp] 72 / 5e-16 AT2G40260 145 / 3e-40 Homeodomain-like superfamily protein (.1) Lus10017442 [exp] 72 / 7e-16 AT2G38300 148 / 3e-41 myb-like HTH transcriptional regulator family protein (.1) Lus10035093 [exp] 72 / 9e-16 AT1G14600 103 / 1e-25 Homeodomain-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G056700 [exp] 85 / 2e-21 AT1G14600 93 / 1e-22 Homeodomain-like superfamily protein (.1) Potri.005G205900 [exp] 85 / 2e-21 AT2G40260 100 / 1e-24 Homeodomain-like superfamily protein (.1) Potri.004G057900 [exp] 82 / 2e-19 AT2G38300 139 / 7e-38 myb-like HTH transcriptional regulator family protein (.1) Potri.016G121800 [exp] 82 / 2e-19 AT2G38300 183 / 1e-54 myb-like HTH transcriptional regulator family protein (.1) Potri.010G185700 [exp] 80 / 6e-19 AT2G40260 188 / 5e-56 Homeodomain-like superfamily protein (.1) Potri.008G142000 [exp] 79 / 1e-18 AT1G14600 130 / 2e-36 Homeodomain-like superfamily protein (.1) Potri.009G075100 [exp] 79 / 2e-18 AT2G38300 162 / 4e-47 myb-like HTH transcriptional regulator family protein (.1) Potri.011G006350 [exp] 78 / 2e-18 AT2G02060 115 / 8e-31 Homeodomain-like superfamily protein (.1) Potri.010G099600 [exp] 77 / 4e-18 AT1G14600 126 / 9e-35 Homeodomain-like superfamily protein (.1) Potri.001G280000 [exp] 78 / 5e-18 AT2G38300 140 / 2e-38 myb-like HTH transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF00249 [flax] [poplar] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Lus10029808 pacid=23159854 polypeptide=Lus10029808 locus=Lus10029808.g ID=Lus10029808.BGIv1.0 annot-version=v1.0 ATGGAGGATAATATCGTCAATATTCACAACCACCACCGCCGGAGACGGAGCAGGTGGAGGAGAAGCAGCGGCGGCAGTGGTGGTGCGCGGCCTTATAACA AGTCGGAGCTGCCGCGCTTCAGGTGGACTCCTCAGCTTCATCTCCACTTCATCCACGCCGTCCACTCCCTCGGCGGCATACACAAGGCGACGCCGAAGCG GATACTGCAGGCGATGAATAACGTAGAAGGGCTCAAGATTTCTCATGTTAAAAGCCATCTCCAGGTTCCTTTTTTCTATCATCACTCTTCATCCTTTTCT TCTTCAAACCATGCACAGCTCGATCGATCGCGAATCGAATTTACTTAG
AA sequence Show only first row Show all	>Lus10029808 pacid=23159854 polypeptide=Lus10029808 locus=Lus10029808.g ID=Lus10029808.BGIv1.0 annot-version=v1.0 MEDNIVNIHNHHRRRRSRWRRSSGGSGGARPYNKSELPRFRWTPQLHLHFIHAVHSLGGIHKATPKRILQAMNNVEGLKISHVKSHLQVPFFYHHSSSFS SSNHAQLDRSRIEFT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14600	GARP		Homeodomain-like superfamily p...		Lus10029808 [exp]	0	1
					Lus10015636 [exp]	5.5	0.7850
AT2G32390		GLR6, ATGLR3.5	glutamate receptor 3.5 (.1.2....		Lus10025426 [exp]	9.5	0.8086
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	31.2	0.7229
AT2G24610		ATCNGC14	cyclic nucleotide-gated channe...		Lus10020122 [exp]	31.4	0.7538
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10030779 [exp]	33.0	0.6969
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10008614 [exp]	39.0	0.7561
					Lus10033100 [exp]	43.2	0.6846
AT3G22490			Seed maturation protein (.1)		Lus10010553 [exp]	47.1	0.6448
AT2G15480		UGT73B5	UDP-glucosyl transferase 73B5 ...		Lus10026926 [exp]	47.4	0.7158
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10014757 [exp]	65.3	0.6845

Compare expression of checked genes

Lus10029808 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.