Lus10030747 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20580 214 / 4e-73 Small nuclear ribonucleoprotein family protein (.1)
AT1G76300 206 / 5e-70 SMD3 snRNP core protein SMD3 (.1)
AT5G27720 60 / 2e-12 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
AT4G02840 51 / 5e-09 Small nuclear ribonucleoprotein family protein (.1.2)
AT3G07590 47 / 1e-07 Small nuclear ribonucleoprotein family protein (.1.2)
AT1G20600 40 / 0.0001 B3 AP2/B3-like transcriptional factor family protein (.1)
AT1G03330 38 / 0.0003 Small nuclear ribonucleoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013227 239 / 6e-83 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1)
Lus10012263 237 / 4e-82 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1)
Lus10016013 237 / 4e-82 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1)
Lus10029426 62 / 7e-12 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Lus10004221 61 / 1e-11 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Lus10028022 49 / 4e-08 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10003727 49 / 1e-07 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10025186 46 / 3e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10016068 46 / 3e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G010200 232 / 3e-80 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1)
Potri.005G251100 230 / 2e-79 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G205700 60 / 3e-12 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Potri.014G130700 59 / 9e-12 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Potri.002G054800 52 / 3e-09 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.005G207900 44 / 1e-06 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.004G219000 37 / 0.0005 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
Potri.003G014900 37 / 0.0005 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Lus10030747 pacid=23155250 polypeptide=Lus10030747 locus=Lus10030747.g ID=Lus10030747.BGIv1.0 annot-version=v1.0
ATGAGTAGGAGTTTGGGGATTCCGGTGAAGCTCCTTCACGAGGCCTCCGGCCACATCGTCACTGTGGAGCTGAAAAGCGGCGAGCTTTATAGGGGGAGCA
TGCTGGAGTGCGAAGATAACTGGAATTGCCAACTCGAGAACATTACTTACACCGCTAAGGATGGCAAGATTTCACAGCTTGAACATGTTTTCATCAGAGG
CAGCAAAGTCAGGTTTATGGTCATACCAGATATGCTTAAGAATGCACCTATGTTCAAGCGTCTAGATGCTAGAATCAAGGGCAAGAGCGCATCACTTGGA
GTGGGAAGAGGAAGGTCTGTTGCCATGCGGGCGAAAGCACAGACTGCTGCTGGAGGCCGTGGAGGACCTGGTAGGGGAGCTGTACCACCTGTTCGAAGAT
AA
AA sequence
>Lus10030747 pacid=23155250 polypeptide=Lus10030747 locus=Lus10030747.g ID=Lus10030747.BGIv1.0 annot-version=v1.0
MSRSLGIPVKLLHEASGHIVTVELKSGELYRGSMLECEDNWNCQLENITYTAKDGKISQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSASLG
VGRGRSVAMRAKAQTAAGGRGGPGRGAVPPVRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20580 Small nuclear ribonucleoprotei... Lus10030747 0 1
AT5G40570 Surfeit locus protein 2 (SURF2... Lus10003658 1.0 0.8704
AT1G27435 unknown protein Lus10041533 1.7 0.8240
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10009889 2.0 0.8531
AT3G24080 KRR1 family protein (.1.2) Lus10028084 4.5 0.8121
AT5G20130 unknown protein Lus10037880 6.0 0.7918
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032560 6.3 0.8067
AT5G04280 AtRZ-1c AtRZ-1c, RNA-binding (RRM/RBD/... Lus10038683 6.5 0.8064
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10014843 7.0 0.8040
AT5G63690 Nucleic acid-binding, OB-fold-... Lus10035799 8.5 0.7505
AT5G24165 unknown protein Lus10014921 9.5 0.7701

Lus10030747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.