Lus10032111 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14345 140 / 4e-43 AtENODL21 early nodulin-like protein 21 (.1)
AT1G48940 134 / 4e-40 AtENODL6 early nodulin-like protein 6 (.1)
AT3G18590 133 / 1e-39 AtENODL5 early nodulin-like protein 5 (.1)
AT1G79800 115 / 1e-32 AtENODL7 early nodulin-like protein 7 (.1)
AT4G28365 103 / 6e-28 AtENODL3 early nodulin-like protein 3 (.1)
AT2G25060 101 / 3e-27 AtENODL14 early nodulin-like protein 14 (.1)
AT4G31840 99 / 1e-26 AtENODL15 early nodulin-like protein 15 (.1)
AT3G20570 94 / 2e-24 AtENODL9 early nodulin-like protein 9 (.1)
AT4G32490 92 / 3e-23 AtENODL4 early nodulin-like protein 4 (.1)
AT4G30590 91 / 4e-23 AtENODL12 early nodulin-like protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022318 212 / 1e-70 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Lus10014880 205 / 7e-68 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1)
Lus10014575 180 / 1e-53 AT5G40640 714 / 0.0 unknown protein
Lus10009617 124 / 5e-36 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1)
Lus10011158 100 / 1e-26 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10043063 99 / 4e-26 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10039852 94 / 4e-24 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10026880 94 / 4e-24 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10018617 94 / 5e-24 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G338800 177 / 2e-57 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
Potri.015G052000 135 / 7e-41 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.015G113300 124 / 9e-37 AT5G14345 110 / 9e-32 early nodulin-like protein 21 (.1)
Potri.015G114600 117 / 1e-33 AT5G14345 97 / 2e-26 early nodulin-like protein 21 (.1)
Potri.003G050500 107 / 2e-29 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
Potri.006G264600 105 / 6e-29 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.018G018200 102 / 9e-28 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.001G187700 100 / 1e-26 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.006G184100 98 / 6e-26 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.011G135400 98 / 1e-25 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10032111 pacid=23161176 polypeptide=Lus10032111 locus=Lus10032111.g ID=Lus10032111.BGIv1.0 annot-version=v1.0
ATGGATTCATCAAAGCTCATACTCTTGTTGATGCTGTTGTCTACTACAACAGTTCATTCATTTGACCACCAAGTTGGTGGATCCAAAGGCTGGATTGTTC
CTCCTTCCAACGACACCAAATTCTACAATGAGTGGGCTTCTCAGAACAGATTCCTCATTGGTGACACAGTCAGGTTTAGGTACAAGAAGGATTCGGTTAT
GGAGGTGAATGAGGAAGGTTACAAGAGCTGCAACTCCAGCCATCCAAACTACTTCTCCAACACTGGAAACACGGTCTACGAGCTGGATCATTCTGGGCTG
TACTACTTCATCAGCGGAGCTTCTCACCATTGCGACAAAGGGCAGAAGATGATCATCAAGGTCTTGAGTCATGAAGACGATGACAATGGCAATGGCACTA
GCAAGACTCCTCCTTCCCATGACGGCGAAGGTGGTCACAGCAAGTCAGCAGCTGGTTCAACTCTTCCTTCTTCAGTTTTGGCCATGGCTATAGCAACTCT
TGCTGCTTCCATCTACTATTAG
AA sequence
>Lus10032111 pacid=23161176 polypeptide=Lus10032111 locus=Lus10032111.g ID=Lus10032111.BGIv1.0 annot-version=v1.0
MDSSKLILLLMLLSTTTVHSFDHQVGGSKGWIVPPSNDTKFYNEWASQNRFLIGDTVRFRYKKDSVMEVNEEGYKSCNSSHPNYFSNTGNTVYELDHSGL
YYFISGASHHCDKGQKMIIKVLSHEDDDNGNGTSKTPPSHDGEGGHSKSAAGSTLPSSVLAMAIATLAASIYY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14345 AtENODL21 early nodulin-like protein 21 ... Lus10032111 0 1
AT2G32360 Ubiquitin-like superfamily pro... Lus10015125 6.3 0.9012
AT3G01490 Protein kinase superfamily pro... Lus10030621 11.0 0.7309
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10016175 12.3 0.8757
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10039946 18.4 0.7385
AT1G30050 unknown protein Lus10035609 18.5 0.8651
AT3G03080 Zinc-binding dehydrogenase fam... Lus10003638 21.4 0.8638
AT4G26330 ATSBT3.18, UNE1... UNFERTILIZED EMBRYO SAC 17, Su... Lus10029569 23.3 0.6735
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10035169 23.6 0.8616
AT5G67240 SDN3 small RNA degrading nuclease 3... Lus10019320 24.2 0.7042
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10018624 26.5 0.8575

Lus10032111 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.