Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 66 / 2e-13 NB-ARC domain-containing disease resistance protein (.1) AT1G58390 53 / 6e-09 Disease resistance protein (CC-NBS-LRR class) family (.1) AT3G50950 52 / 8e-09 ZAR1 HOPZ-ACTIVATED RESISTANCE 1 (.1.2) AT1G59620 52 / 9e-09 CW9 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G35450 52 / 1e-08 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G53350 52 / 1e-08 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58400 52 / 2e-08 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58410 52 / 2e-08 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58602 50 / 4e-08 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT1G59780 50 / 8e-08 NB-ARC domain-containing disease resistance protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003571 [exp] 166 / 2e-48 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10004127 [exp] 142 / 4e-40 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10004126 [exp] 142 / 4e-40 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10002609 [exp] 141 / 6e-40 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10000934 [exp] 130 / 4e-37 AT3G04950 256 / 8e-84 unknown protein Lus10022900 [exp] 126 / 1e-34 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10029704 [exp] 113 / 5e-32 AT3G14470 92 / 7e-21 NB-ARC domain-containing disease resistance protein (.1) Lus10022792 [exp] 108 / 3e-28 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10022351 [exp] 67 / 7e-14 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G121800 [exp] 77 / 2e-17 AT3G14470 377 / 3e-114 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121750 [exp] 77 / 2e-17 AT3G14470 338 / 8e-103 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123400 [exp] 77 / 2e-17 AT3G14470 376 / 2e-115 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121876 [exp] 76 / 4e-17 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121851 [exp] 76 / 8e-17 AT3G14470 348 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121801 [exp] 73 / 5e-16 AT3G14470 410 / 3e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122200 [exp] 71 / 3e-15 AT3G14470 411 / 2e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123000 [exp] 70 / 5e-15 AT3G14470 144 / 4e-38 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123500 [exp] 70 / 8e-15 AT3G14470 395 / 4e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123200 [exp] 69 / 1e-14 AT3G14470 407 / 1e-125 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10032781 pacid=23159013 polypeptide=Lus10032781 locus=Lus10032781.g ID=Lus10032781.BGIv1.0 annot-version=v1.0 ATGTTCGGTTTTACTGCTAAACCAGCTGTAATATTGTACAAAAGTCTGCCAACTAGCTCCCTTATCAAATTCTCGGATGTGAAAGGCAGAGAAGAAGAGA CAGAGTTACTAAAAGAAAAGTTGCTACAAATTAGTGGTGATCATGTTCAGAGTATCTCTATTCAAGGTGCTGGTGGACTTGGAAAAAACACATTAGCAAA ACTGCTATACAATGACAAAGTCGTGGTAGATCATTTCGGCAAGAGAATTTGGGTTTGTGTGCCCGACACTTTTGACCCAACTACGGTCGCTAAGAACATA CTTGAATCTCTTATTGATTCTGCTCAACAAATTAACACATTGTCAATCATGTTGGAGAATGATGAACAGATTTTGCTCGTTTCAAAATAA
AA sequence Show only first row Show all	>Lus10032781 pacid=23159013 polypeptide=Lus10032781 locus=Lus10032781.g ID=Lus10032781.BGIv1.0 annot-version=v1.0 MFGFTAKPAVILYKSLPTSSLIKFSDVKGREEETELLKEKLLQISGDHVQSISIQGAGGLGKNTLAKLLYNDKVVVDHFGKRIWVCVPDTFDPTTVAKNI LESLIDSAQQINTLSIMLENDEQILLVSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14470			NB-ARC domain-containing disea...		Lus10032781 [exp]	0	1
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	2.8	0.9417
					Lus10028949 [exp]	3.0	0.8862
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028002 [exp]	3.5	0.8695
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	4.0	0.9417
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	4.9	0.9417
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	5.7	0.9392
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	6.3	0.9375
AT2G33100		ATCSLD1	CELLULOSE-SYNTHASE LIKE D1, ce...		Lus10011736 [exp]	7.0	0.7215
AT3G44220			Late embryogenesis abundant (L...		Lus10005214 [exp]	7.5	0.9090
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	8.0	0.8981

Compare expression of checked genes

Lus10032781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.