Lus10033227 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64640 166 / 4e-52 AtENODL8 early nodulin-like protein 8 (.1)
AT1G79800 84 / 5e-20 AtENODL7 early nodulin-like protein 7 (.1)
AT5G53870 85 / 2e-19 AtENODL1 early nodulin-like protein 1 (.1)
AT3G20570 82 / 3e-19 AtENODL9 early nodulin-like protein 9 (.1)
AT4G28365 81 / 8e-19 AtENODL3 early nodulin-like protein 3 (.1)
AT1G48940 78 / 3e-18 AtENODL6 early nodulin-like protein 6 (.1)
AT4G32490 78 / 8e-18 AtENODL4 early nodulin-like protein 4 (.1)
AT4G30590 76 / 3e-17 AtENODL12 early nodulin-like protein 12 (.1)
AT2G23990 76 / 3e-17 AtENODL11 early nodulin-like protein 11 (.1.2)
AT4G31840 75 / 5e-17 AtENODL15 early nodulin-like protein 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000336 304 / 2e-105 AT1G64650 170 / 1e-52 Major facilitator superfamily protein (.1.2)
Lus10043063 85 / 2e-20 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10032111 82 / 2e-19 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10011158 82 / 3e-19 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10022318 82 / 3e-19 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Lus10014880 78 / 5e-18 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1)
Lus10003432 76 / 5e-17 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10026880 75 / 8e-17 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10018758 72 / 7e-16 AT1G79800 142 / 2e-43 early nodulin-like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G085100 219 / 3e-73 AT1G64640 150 / 3e-46 early nodulin-like protein 8 (.1)
Potri.011G135400 94 / 8e-24 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.001G338800 86 / 3e-21 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
Potri.018G018200 82 / 1e-19 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.015G052000 81 / 5e-19 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.006G264600 80 / 7e-19 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.001G187700 78 / 4e-18 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.011G117800 81 / 6e-18 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.001G419200 79 / 6e-18 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.003G050500 78 / 7e-18 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10033227 pacid=23172115 polypeptide=Lus10033227 locus=Lus10033227.g ID=Lus10033227.BGIv1.0 annot-version=v1.0
ATGACCAATCTTACAACTCCCAAGTTCCTGGCTCTCTGTGCCTTTCAGCTTCTTGCTTTGCTTCACATCCAAGTCTCCTGCTACCAGTACAAGGTTGGAG
ATTTAGACGCTTGGGGGATCCCCACTGACTCAAACCCCAAAGTCTACATCTATTGGTCCAAATATCACAACTTAACTGTTGGAGATTCCCTCTTGTTTCT
GTACCCACCAAGCCAAGACTCAGTAATCCAAGTAACCCCACAGAACTTCGACTCCTGCAACCTGAAAAACCCAATCTTGTACATGAACAATGGCAACTCC
TTGTTCAACATCACCCAAGAAGGTGTGTTTTACTTCACCAGTGGGGAGCCAGGACGCTGCGAGAAGAAGCAGAAGATTCGGATAACTGTAGGGAATGAAT
CTGCAACTGCTTATCCTCCTTCTTACGGCCCTGGTGGAGCATTGGCTGATTCTGCTCCCACTTCCCCGATTGCATTTGGATCCATCCCTACTTCTTCTTC
CTCTTATTCATTGGAACCCAGATTCTCTGTCCTCTTATCAGTTGTTATTGGATCGCTGGTCTCTGGTATTATGAGAGCAGGATTCATGTGA
AA sequence
>Lus10033227 pacid=23172115 polypeptide=Lus10033227 locus=Lus10033227.g ID=Lus10033227.BGIv1.0 annot-version=v1.0
MTNLTTPKFLALCAFQLLALLHIQVSCYQYKVGDLDAWGIPTDSNPKVYIYWSKYHNLTVGDSLLFLYPPSQDSVIQVTPQNFDSCNLKNPILYMNNGNS
LFNITQEGVFYFTSGEPGRCEKKQKIRITVGNESATAYPPSYGPGGALADSAPTSPIAFGSIPTSSSSYSLEPRFSVLLSVVIGSLVSGIMRAGFM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 0 1
AT1G64650 Major facilitator superfamily ... Lus10000336 1.0 0.9914
Lus10024349 2.4 0.9816
AT3G24450 Heavy metal transport/detoxifi... Lus10017730 3.2 0.9710
AT5G11420 Protein of unknown function, D... Lus10025753 3.9 0.9813
AT2G03350 Protein of unknown function, D... Lus10036804 4.5 0.9805
AT5G20950 Glycosyl hydrolase family prot... Lus10043457 4.5 0.9790
AT3G61640 AGP20, ATAGP20 arabinogalactan protein 20 (.1... Lus10033939 4.9 0.9769
AT1G47740 PPPDE putative thiol peptidase... Lus10011291 5.3 0.9683
AT3G04730 AUX_IAA IAA16 indoleacetic acid-induced prot... Lus10018765 5.7 0.9717
AT4G14550 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic... Lus10018766 5.9 0.9724

Lus10033227 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.