Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66900 114 / 2e-29 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G66630 110 / 3e-28 DAR5 DA1-related protein 5 (.1) AT5G66910 97 / 2e-23 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58410 47 / 2e-06 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G33560 47 / 2e-06 ADR1 ACTIVATED DISEASE RESISTANCE 1, Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G47280 47 / 3e-06 ADR1-L3 ADR1-like 3 (.1) AT5G04720 47 / 4e-06 PHX21, ADR1-L2 PHOENIX 21, ADR1-like 2 (.1) AT5G43470 46 / 9e-06 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT5G48620 45 / 1e-05 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G53350 44 / 3e-05 Disease resistance protein (CC-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034761 [exp] 369 / 8e-128 AT5G66900 197 / 1e-54 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10022464 [exp] 167 / 3e-48 AT5G66900 531 / 2e-177 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10020779 [exp] 130 / 4e-35 AT5G66900 434 / 5e-141 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10007359 [exp] 125 / 2e-33 AT5G66900 473 / 3e-154 Disease resistance protein (CC-NBS-LRR class) family (.1) Lus10021769 [exp] 66 / 1e-12 AT4G33300 583 / 0.0 ADR1-like 1 (.1.2) Lus10026765 [exp] 39 / 0.0002 AT3G07040 71 / 2e-15 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10016316 [exp] 40 / 0.0008 AT3G14470 494 / 6e-156 NB-ARC domain-containing disease resistance protein (.1) Lus10032759 [exp] 40 / 0.001 AT1G33560 543 / 0.0 ACTIVATED DISEASE RESISTANCE 1, Disease resistance protein (CC-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G039000 [exp] 167 / 2e-48 AT5G66900 343 / 2e-107 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.007G039100 [exp] 164 / 4e-47 AT5G66900 474 / 3e-156 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.007G038700 [exp] 141 / 7e-39 AT5G66900 481 / 3e-158 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.007G039300 [exp] 132 / 7e-36 AT5G66900 540 / 0.0 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.014G035700 [exp] 59 / 4e-10 AT4G33300 889 / 0.0 ADR1-like 1 (.1.2) Potri.002G129300 [exp] 57 / 9e-10 AT4G33300 902 / 0.0 ADR1-like 1 (.1.2) Potri.003G201900 [exp] 48 / 2e-06 AT3G14470 567 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.003G149800 [exp] 46 / 5e-06 AT5G43470 421 / 4e-133 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) Potri.003G150200 [exp] 44 / 3e-05 AT5G43470 420 / 2e-132 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) Potri.006G014400 [exp] 44 / 3e-05 AT3G50950 435 / 1e-139 HOPZ-ACTIVATED RESISTANCE 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10033299 pacid=23172052 polypeptide=Lus10033299 locus=Lus10033299.g ID=Lus10033299.BGIv1.0 annot-version=v1.0 ATGCAGATCATTCAATTTGCAGACCAGAAAGAAACCTTGTTTGAAGTCAAACAGCTGAACAGCCAAATTAGGAAGTCCCTCCCTCGATCACTTTTAGGTC TCTGCTCCCCTTCTGATTTGAAAGTTGATCCAGTAGGGTTAGAAACTCCGTTGATGGAGTTGAAAGAACAGCTGCTCGGAGATGAGCTCCCACTTGTTGT CATTTCTGCTCCTGATGGATGGGGGAAAACCACTCTCGCTACAGCAATCTGCCAGGATACACAAGTTAAAGATAGATTTAAGGGGAATATATTATTTGTC ACTGCTGGGAGAAGTCCTAACATGATGGCTATAGTGGGTAGACTTCTTGAGCACTACAATTGCCCACTACCTGAACTACAGAGTGAAGATGAAGCTATCT TTGAACTAGAGAACCTTATGAGGAAGATACAATCTCAGCCGGTTCTTTTGGTAATTGATGATCTTTCGGCTGGATCAGAATCTCTTCTTCTGAGACTCAA GTTCCAAATACAGAATTACCAGATTTTGGTGACCTCTAGTTCCGAGTTCCCCAGAATTAGTTCCACATACAAAATGTAA
AA sequence Show only first row Show all	>Lus10033299 pacid=23172052 polypeptide=Lus10033299 locus=Lus10033299.g ID=Lus10033299.BGIv1.0 annot-version=v1.0 MQIIQFADQKETLFEVKQLNSQIRKSLPRSLLGLCSPSDLKVDPVGLETPLMELKEQLLGDELPLVVISAPDGWGKTTLATAICQDTQVKDRFKGNILFV TAGRSPNMMAIVGRLLEHYNCPLPELQSEDEAIFELENLMRKIQSQPVLLVIDDLSAGSESLLLRLKFQIQNYQILVTSSSEFPRISSTYKM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66900			Disease resistance protein (CC...		Lus10033299 [exp]	0	1
					Lus10033298 [exp]	1.4	0.8831
AT5G66900			Disease resistance protein (CC...		Lus10034761 [exp]	3.9	0.8709
AT2G39435			Phosphatidylinositol N-acetygl...		Lus10030320 [exp]	4.0	0.8736
AT2G35510		SRO1	similar to RCD one 1 (.1)		Lus10035390 [exp]	6.0	0.8543
AT1G78760			F-box/RNI-like superfamily pro...		Lus10024701 [exp]	6.6	0.8435
AT5G60580			RING/U-box superfamily protein...		Lus10021482 [exp]	7.1	0.8435
AT4G33620			Cysteine proteinases superfami...		Lus10020445 [exp]	9.5	0.8461
AT4G02020		SDG10, SWINGER,...	SWINGER, SET DOMAIN-CONTAINING...		Lus10041386 [exp]	9.7	0.8593
AT5G17460			unknown protein		Lus10009117 [exp]	13.5	0.8366
AT1G03670			ankyrin repeat family protein ...		Lus10020209 [exp]	13.7	0.8334

Compare expression of checked genes

Lus10033299 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.